Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   QU610_RS00200 Genome accession   NZ_CP129105
Coordinates   37004..37117 (+) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   G2MCV1
Organism   Helicobacter pylori strain HP45k     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 32004..42117
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QU610_RS00175 (QU610_00175) - 32057..34282 (+) 2226 WP_137296256.1 ATP-dependent Clp protease ATP-binding subunit -
  QU610_RS00180 (QU610_00180) panD 34272..34625 (+) 354 WP_000142239.1 aspartate 1-decarboxylase -
  QU610_RS00185 (QU610_00185) - 34628..34930 (+) 303 WP_000347926.1 YbaB/EbfC family nucleoid-associated protein -
  QU610_RS00190 (QU610_00190) - 34930..35925 (+) 996 WP_137296274.1 PDZ domain-containing protein -
  QU610_RS00195 (QU610_00195) comB6 35933..36988 (+) 1056 WP_137296273.1 P-type conjugative transfer protein TrbL Machinery gene
  QU610_RS00200 (QU610_00200) comB7 37004..37117 (+) 114 WP_001217873.1 hypothetical protein Machinery gene
  QU610_RS00205 (QU610_00205) comB8 37114..37857 (+) 744 WP_137296255.1 virB8 family protein Machinery gene
  QU610_RS00210 (QU610_00210) comB9 37857..38825 (+) 969 WP_137296254.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  QU610_RS00215 (QU610_00215) comB10 38818..39954 (+) 1137 WP_137296253.1 DNA type IV secretion system protein ComB10 Machinery gene
  QU610_RS00220 (QU610_00220) - 40024..41436 (+) 1413 WP_137296252.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=850862 QU610_RS00200 WP_001217873.1 37004..37117(+) (comB7) [Helicobacter pylori strain HP45k]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=850862 QU610_RS00200 WP_001217873.1 37004..37117(+) (comB7) [Helicobacter pylori strain HP45k]
ATGAGAATTTTTTTTGTTATTATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G2MCV1

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1