Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | QTL84_RS16240 | Genome accession | NZ_CP128559 |
| Coordinates | 3218460..3218600 (-) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus velezensis strain SH-1471 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3213460..3223600
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QTL84_RS16215 | - | 3213774..3214157 (-) | 384 | WP_014418761.1 | hotdog fold thioesterase | - |
| QTL84_RS16220 | comA | 3214179..3214823 (-) | 645 | WP_014418762.1 | response regulator transcription factor | Regulator |
| QTL84_RS16225 | comP | 3214904..3217255 (-) | 2352 | WP_269800792.1 | histidine kinase | Regulator |
| QTL84_RS16230 | comX | 3217233..3217403 (-) | 171 | WP_032863917.1 | competence pheromone ComX | - |
| QTL84_RS16235 | - | 3217403..3218329 (-) | 927 | WP_014721741.1 | polyprenyl synthetase family protein | - |
| QTL84_RS16240 | degQ | 3218460..3218600 (-) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| QTL84_RS16245 | - | 3219066..3219407 (+) | 342 | WP_014418765.1 | hypothetical protein | - |
| QTL84_RS16250 | - | 3219414..3220637 (-) | 1224 | WP_014418766.1 | EAL and HDOD domain-containing protein | - |
| QTL84_RS16255 | - | 3220767..3222233 (-) | 1467 | WP_014418767.1 | nicotinate phosphoribosyltransferase | - |
| QTL84_RS16260 | - | 3222251..3222802 (-) | 552 | WP_003152033.1 | isochorismatase family cysteine hydrolase | - |
| QTL84_RS16265 | - | 3222899..3223297 (-) | 399 | WP_003152031.1 | DUF1694 domain-containing protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=849009 QTL84_RS16240 WP_003152043.1 3218460..3218600(-) (degQ) [Bacillus velezensis strain SH-1471]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=849009 QTL84_RS16240 WP_003152043.1 3218460..3218600(-) (degQ) [Bacillus velezensis strain SH-1471]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |