Detailed information    

insolico Bioinformatically predicted

Overview


Name   pilE   Type   Machinery gene
Locus tag   V5F95_RS09090 Genome accession   NZ_CP145032
Coordinates   1739965..1740108 (+) Length   47 a.a.
NCBI ID   WP_003691943.1    Uniprot ID   -
Organism   Neisseria gonorrhoeae strain WHO_Q_2024     
Function   assembly of type IV pilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1734965..1745108
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V5F95_RS09055 (V5F95_09065) - 1735551..1735937 (+) 387 Protein_1760 pilin -
  V5F95_RS09060 (V5F95_09070) - 1735978..1736328 (+) 351 Protein_1761 pilin -
  V5F95_RS09065 (V5F95_09075) - 1736369..1736719 (+) 351 Protein_1762 pilin -
  V5F95_RS09070 (V5F95_09080) pilE 1736776..1737084 (+) 309 WP_269460796.1 pilin Machinery gene
  V5F95_RS09075 (V5F95_09090) lpxC 1737751..1738674 (+) 924 WP_003687007.1 UDP-3-O-acyl-N-acetylglucosamine deacetylase -
  V5F95_RS09080 (V5F95_09095) - 1738803..1739255 (+) 453 Protein_1765 pilin -
  V5F95_RS09085 (V5F95_09100) - 1739221..1739547 (+) 327 Protein_1766 pilin -
  V5F95_RS09090 (V5F95_09105) pilE 1739965..1740108 (+) 144 WP_003691943.1 hypothetical protein Machinery gene
  V5F95_RS09095 (V5F95_09110) pilE 1740479..1740964 (+) 486 WP_353105695.1 pilin Machinery gene
  V5F95_RS09100 (V5F95_09115) - 1740991..1741265 (+) 275 Protein_1769 pilin -
  V5F95_RS09105 (V5F95_09120) - 1741308..1741490 (+) 183 Protein_1770 pilin -
  V5F95_RS09110 (V5F95_09125) - 1742027..1742818 (+) 792 WP_149032455.1 opacity family porin -
  V5F95_RS09115 (V5F95_09130) - 1742832..1743047 (+) 216 WP_172587022.1 hypothetical protein -
  V5F95_RS09120 (V5F95_09135) pilA 1743083..1744336 (-) 1254 WP_003696286.1 signal recognition particle-docking protein FtsY Machinery gene

Sequence


Protein


Download         Length: 47 a.a.        Molecular weight: 5034.54 Da        Isoelectric Point: 7.2428

>NTDB_id=849010 V5F95_RS09090 WP_003691943.1 1739965..1740108(+) (pilE) [Neisseria gonorrhoeae strain WHO_Q_2024]
MTGFNDAAGNDKIDTKHLPSTCRDKSSAVCTKHHAPISNAFQENGAF

Nucleotide


Download         Length: 144 bp        

>NTDB_id=849010 V5F95_RS09090 WP_003691943.1 1739965..1740108(+) (pilE) [Neisseria gonorrhoeae strain WHO_Q_2024]
ATGACGGGATTTAATGATGCCGCCGGCAACGACAAAATCGACACCAAGCACCTGCCGTCAACCTGCCGCGATAAATCATC
TGCCGTTTGCACGAAACACCACGCGCCGATTTCAAATGCTTTCCAAGAAAACGGAGCTTTTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilE Neisseria gonorrhoeae strain FA1090

70

63.83

0.447