Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   N7E01_RS05215 Genome accession   NZ_CP128233
Coordinates   988675..989133 (-) Length   152 a.a.
NCBI ID   WP_289174852.1    Uniprot ID   -
Organism   Neopusillimonas aromaticivorans strain CC-YST667     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 955353..1015847 988675..989133 within 0


Gene organization within MGE regions


Location: 955353..1015847
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  N7E01_RS05030 (N7E01_05030) - 955410..956666 (+) 1257 WP_289174832.1 integrase arm-type DNA-binding domain-containing protein -
  N7E01_RS05035 (N7E01_05035) - 956727..957038 (+) 312 WP_128355399.1 type II toxin-antitoxin system RelE/ParE family toxin -
  N7E01_RS05040 (N7E01_05040) nadS 957040..957327 (+) 288 WP_128355400.1 NadS family protein -
  N7E01_RS05045 (N7E01_05045) - 957403..957693 (+) 291 WP_128355401.1 hypothetical protein -
  N7E01_RS05050 (N7E01_05050) - 957745..958416 (+) 672 WP_128355402.1 TrbM/KikA/MpfK family conjugal transfer protein -
  N7E01_RS05055 (N7E01_05055) - 958427..959092 (+) 666 WP_128355403.1 lytic transglycosylase domain-containing protein -
  N7E01_RS05060 (N7E01_05060) - 959175..959495 (+) 321 WP_128355404.1 TrbC/VirB2 family protein -
  N7E01_RS05065 (N7E01_05065) - 959499..959927 (+) 429 WP_289174833.1 VirB3 family type IV secretion system protein -
  N7E01_RS05070 (N7E01_05070) - 959830..961476 (+) 1647 WP_228255706.1 hypothetical protein -
  N7E01_RS05075 (N7E01_05075) - 961383..962273 (+) 891 WP_289174834.1 hypothetical protein -
  N7E01_RS05080 (N7E01_05080) - 962283..962828 (+) 546 WP_128355406.1 hypothetical protein -
  N7E01_RS05085 (N7E01_05085) - 963022..963402 (+) 381 WP_128355407.1 hypothetical protein -
  N7E01_RS05090 (N7E01_05090) - 963772..964473 (-) 702 WP_289174835.1 hypothetical protein -
  N7E01_RS05095 (N7E01_05095) - 964908..965612 (+) 705 WP_128355409.1 type IV secretion system protein -
  N7E01_RS05100 (N7E01_05100) - 965687..966574 (+) 888 WP_289174836.1 type IV secretion system protein -
  N7E01_RS05105 (N7E01_05105) - 966651..966788 (+) 138 WP_026483152.1 hypothetical protein -
  N7E01_RS05110 (N7E01_05110) - 966792..967478 (+) 687 WP_128355411.1 type IV secretion system protein -
  N7E01_RS05115 (N7E01_05115) virB9 967509..968303 (+) 795 WP_289174837.1 P-type conjugative transfer protein VirB9 -
  N7E01_RS05120 (N7E01_05120) - 968368..968529 (+) 162 WP_289174838.1 hypothetical protein -
  N7E01_RS05125 (N7E01_05125) virB11 968733..970472 (+) 1740 WP_289174839.1 P-type DNA transfer ATPase VirB11 -
  N7E01_RS05130 (N7E01_05130) - 970602..971519 (+) 918 WP_128355415.1 TrfA -
  N7E01_RS05135 (N7E01_05135) - 971969..972427 (+) 459 WP_128355416.1 hypothetical protein -
  N7E01_RS05140 (N7E01_05140) stbB 972912..973619 (+) 708 WP_128355418.1 StbB family protein -
  N7E01_RS05145 (N7E01_05145) - 973626..974060 (+) 435 WP_128355419.1 hypothetical protein -
  N7E01_RS05150 (N7E01_05150) - 974066..975217 (+) 1152 WP_289174840.1 type IV secretion system DNA-binding domain-containing protein -
  N7E01_RS05155 (N7E01_05155) - 975177..975683 (+) 507 WP_289174841.1 type IV secretion system DNA-binding domain-containing protein -
  N7E01_RS05160 (N7E01_05160) - 975978..976700 (-) 723 WP_289174842.1 AAA family ATPase -
  N7E01_RS05165 (N7E01_05165) - 976697..978292 (-) 1596 WP_289174843.1 hypothetical protein -
  N7E01_RS05170 (N7E01_05170) - 978579..978803 (-) 225 WP_289174844.1 transcriptional regulator -
  N7E01_RS05175 (N7E01_05175) - 978855..979067 (-) 213 WP_289174845.1 hypothetical protein -
  N7E01_RS05180 (N7E01_05180) - 979064..981454 (-) 2391 WP_289174846.1 DEAD/DEAH box helicase family protein -
  N7E01_RS05185 (N7E01_05185) - 981458..982465 (-) 1008 WP_289174847.1 DNA methyltransferase -
  N7E01_RS05190 (N7E01_05190) - 982776..983582 (-) 807 WP_289174848.1 DNA methyltransferase -
  N7E01_RS05195 (N7E01_05195) - 983612..984184 (-) 573 WP_113934837.1 recombinase family protein -
  N7E01_RS05200 (N7E01_05200) mobF 984435..985826 (+) 1392 WP_289174849.1 MobF family relaxase -
  N7E01_RS05205 (N7E01_05205) - 985744..987333 (+) 1590 WP_289174850.1 AAA family ATPase -
  N7E01_RS05210 (N7E01_05210) - 987884..988558 (+) 675 WP_289174851.1 SOS response-associated peptidase family protein -
  N7E01_RS05215 (N7E01_05215) ssb 988675..989133 (-) 459 WP_289174852.1 single-stranded DNA-binding protein Machinery gene
  N7E01_RS05220 (N7E01_05220) - 989201..990010 (-) 810 WP_289174853.1 DUF3560 domain-containing protein -
  N7E01_RS05225 (N7E01_05225) - 991141..992439 (+) 1299 WP_289174854.1 reverse transcriptase domain-containing protein -
  N7E01_RS05230 (N7E01_05230) - 992496..993023 (-) 528 WP_289174855.1 JAB domain-containing protein -
  N7E01_RS05235 (N7E01_05235) - 993440..994480 (-) 1041 WP_289174856.1 Y-family DNA polymerase -
  N7E01_RS05240 (N7E01_05240) intI1 994697..995711 (-) 1015 Protein_1031 class 1 integron integrase IntI1 -
  N7E01_RS05245 (N7E01_05245) dfrA12 995856..996353 (+) 498 WP_001083725.1 trimethoprim-resistant dihydrofolate reductase DfrA12 -
  N7E01_RS05250 (N7E01_05250) - 996505..996753 (+) 249 WP_224450643.1 DUF1010 domain-containing protein -
  N7E01_RS05255 (N7E01_05255) - 996759..997597 (+) 839 Protein_1034 AadA family aminoglycoside 3''-O-nucleotidyltransferase -
  N7E01_RS05265 (N7E01_05265) - 997783..998477 (+) 695 Protein_1035 alpha/beta fold hydrolase -
  N7E01_RS05270 (N7E01_05270) - 998616..999134 (+) 519 WP_151283906.1 AacA4 family aminoglycoside N(6')-acetyltransferase -
  N7E01_RS05275 (N7E01_05275) - 999203..1000003 (+) 801 WP_032491804.1 OXA-10 family extended-spectrum class D beta-lactamase OXA-17 -
  N7E01_RS05280 (N7E01_05280) - 1000123..1000260 (+) 138 WP_226955427.1 hypothetical protein -
  N7E01_RS05285 (N7E01_05285) - 1000270..1001329 (-) 1060 Protein_1039 IS110-like element ISPa25 family transposase -
  N7E01_RS05290 (N7E01_05290) - 1001521..1001868 (+) 348 WP_000679427.1 quaternary ammonium compound efflux SMR transporter QacE delta 1 -
  N7E01_RS05295 (N7E01_05295) folP 1001862..1002791 (+) 930 WP_289174857.1 dihydropteroate synthase -
  N7E01_RS05300 (N7E01_05300) floR 1002974..1004187 (+) 1214 Protein_1042 chloramphenicol/florfenicol efflux MFS transporter FloR -
  N7E01_RS18450 - 1004215..1004295 (+) 81 Protein_1043 LysR family transcriptional regulator -
  N7E01_RS05305 (N7E01_05305) - 1004281..1004397 (+) 117 Protein_1044 DUF3363 domain-containing protein -
  N7E01_RS05310 (N7E01_05310) tetR(G) 1004394..1005020 (-) 627 WP_000163574.1 tetracycline resistance transcriptional repressor TetR(G) -
  N7E01_RS05315 (N7E01_05315) tet(G) 1005124..1006298 (+) 1175 Protein_1046 tetracycline efflux MFS transporter Tet(G) -
  N7E01_RS05320 (N7E01_05320) - 1006391..1007110 (+) 720 WP_023139374.1 LysR family transcriptional regulator -
  N7E01_RS05325 (N7E01_05325) - 1007202..1008686 (-) 1485 WP_022742855.1 IS91 family transposase -
  N7E01_RS05330 (N7E01_05330) - 1008961..1009311 (-) 351 Protein_1049 TCP-1/cpn60 chaperonin family protein -
  N7E01_RS05335 (N7E01_05335) intI1 1009315..1009614 (-) 300 Protein_1050 class 1 integron integrase IntI1 -
  N7E01_RS05340 (N7E01_05340) aac(6')-Ib 1009774..1010328 (+) 555 WP_012695458.1 AAC(6')-Ib family aminoglycoside 6'-N-acetyltransferase -
  N7E01_RS05345 (N7E01_05345) - 1010503..1010835 (+) 333 WP_032492097.1 quaternary ammonium compound efflux SMR transporter QacF -
  N7E01_RS05350 (N7E01_05350) dfrA12 1010908..1011405 (+) 498 WP_001083725.1 trimethoprim-resistant dihydrofolate reductase DfrA12 -
  N7E01_RS05355 (N7E01_05355) - 1011517..1011807 (+) 291 WP_001336345.1 DUF1010 domain-containing protein -
  N7E01_RS05360 (N7E01_05360) - 1011813..1012651 (+) 839 Protein_1055 AadA family aminoglycoside 3''-O-nucleotidyltransferase -
  N7E01_RS05365 (N7E01_05365) - 1012768..1013115 (+) 348 WP_000679427.1 quaternary ammonium compound efflux SMR transporter QacE delta 1 -
  N7E01_RS05370 (N7E01_05370) sul1 1013109..1013948 (+) 840 WP_000259031.1 sulfonamide-resistant dihydropteroate synthase Sul1 -
  N7E01_RS05375 (N7E01_05375) - 1014075..1014575 (+) 501 Protein_1058 GNAT family N-acetyltransferase -
  N7E01_RS05380 (N7E01_05380) - 1014636..1014887 (+) 252 WP_289174858.1 hypothetical protein -
  N7E01_RS05390 (N7E01_05390) - 1015083..1015847 (+) 765 WP_001389365.1 IS6-like element IS6100 family transposase -

Sequence


Protein


Download         Length: 152 a.a.        Molecular weight: 16600.65 Da        Isoelectric Point: 8.8753

>NTDB_id=846877 N7E01_RS05215 WP_289174852.1 988675..989133(-) (ssb) [Neopusillimonas aromaticivorans strain CC-YST667]
MASLNRATLIGNLGKDPEVRYTAEGAAVCSASIATTHQWKDKATGERREETEWHRVVFYGRLAEVAGEYLRKGRTVFVEG
RLKTRKWQDADTGTDRYTTEIIADQMQLLGSPETAKAGTAQAVPVARPKGRNGKAKAPAAAPDEVEPSDIPF

Nucleotide


Download         Length: 459 bp        

>NTDB_id=846877 N7E01_RS05215 WP_289174852.1 988675..989133(-) (ssb) [Neopusillimonas aromaticivorans strain CC-YST667]
ATGGCATCATTGAACCGCGCTACTCTGATCGGCAACCTTGGCAAAGACCCCGAAGTCCGCTACACCGCAGAAGGTGCAGC
CGTCTGCTCAGCGTCGATTGCTACGACTCACCAATGGAAGGACAAGGCCACAGGCGAGCGCCGCGAAGAAACCGAATGGC
ACCGCGTCGTTTTCTATGGCCGACTGGCTGAAGTCGCCGGTGAGTATCTGCGAAAAGGCCGCACTGTGTTTGTGGAAGGC
CGACTGAAAACCCGCAAATGGCAGGATGCCGACACCGGCACAGACCGCTACACCACGGAAATCATTGCAGACCAAATGCA
GCTGTTGGGCAGCCCAGAGACGGCCAAGGCTGGTACTGCGCAGGCGGTGCCGGTAGCCCGCCCGAAAGGCCGCAACGGCA
AGGCGAAGGCACCCGCTGCAGCGCCTGATGAAGTCGAACCATCAGATATTCCATTCTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

47.191

100

0.553

  ssb Glaesserella parasuis strain SC1401

60.36

73.026

0.441

  ssb Neisseria gonorrhoeae MS11

50.926

71.053

0.362

  ssb Neisseria meningitidis MC58

50.926

71.053

0.362