Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   QLQ02_RS16085 Genome accession   NZ_CP127833
Coordinates   3110873..3111280 (+) Length   135 a.a.
NCBI ID   WP_286058320.1    Uniprot ID   -
Organism   Bacillus mojavensis strain KRS009     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 3105873..3116280
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QLQ02_RS16050 - 3106005..3106955 (+) 951 WP_010334929.1 magnesium transporter CorA family protein -
  QLQ02_RS16055 - 3107190..3107360 (+) 171 WP_286058317.1 CBS domain-containing protein -
  QLQ02_RS16060 comGA 3107712..3108782 (+) 1071 WP_168748237.1 competence protein ComGA Machinery gene
  QLQ02_RS16065 comGB 3108769..3109806 (+) 1038 WP_286058318.1 competence type IV pilus assembly protein ComGB Machinery gene
  QLQ02_RS16070 comGC 3109820..3110116 (+) 297 WP_010334925.1 competence type IV pilus major pilin ComGC Machinery gene
  QLQ02_RS16075 comGD 3110106..3110540 (+) 435 WP_286059883.1 competence type IV pilus minor pilin ComGD Machinery gene
  QLQ02_RS16080 comGE 3110524..3110871 (+) 348 WP_286058319.1 competence type IV pilus minor pilin ComGE Machinery gene
  QLQ02_RS16085 comGF 3110873..3111280 (+) 408 WP_286058320.1 competence type IV pilus minor pilin ComGF Machinery gene
  QLQ02_RS16090 comGG 3111281..3111655 (+) 375 WP_286058321.1 competence type IV pilus minor pilin ComGG Machinery gene
  QLQ02_RS16095 - 3111727..3111906 (+) 180 WP_003236949.1 YqzE family protein -
  QLQ02_RS16100 - 3111949..3112272 (-) 324 WP_168748230.1 YqzG/YhdC family protein -
  QLQ02_RS16105 tapA 3112549..3113310 (+) 762 WP_268451136.1 amyloid fiber anchoring/assembly protein TapA -
  QLQ02_RS16110 - 3113282..3113866 (+) 585 WP_286058322.1 signal peptidase I SipW -
  QLQ02_RS16115 tasA 3113931..3114716 (+) 786 WP_010334917.1 biofilm matrix protein TasA -
  QLQ02_RS16120 sinR 3114804..3115139 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  QLQ02_RS16125 sinI 3115173..3115346 (-) 174 WP_010334916.1 anti-repressor SinI Regulator

Sequence


Protein


Download         Length: 135 a.a.        Molecular weight: 15421.88 Da        Isoelectric Point: 8.5012

>NTDB_id=844471 QLQ02_RS16085 WP_286058320.1 3110873..3111280(+) (comGF) [Bacillus mojavensis strain KRS009]
MLFSLSAYLLISGSLAMFFHLFLARQQENEGFMQREWIISVEQIMNECKQSQTVQTAEHGSVLICRNLSGQEVRFEIYHS
MIRKRVDGKGHVPILGHIKTMKAEVRNGMLWLKVKSENDKEYQTAVPVYTSLGGG

Nucleotide


Download         Length: 408 bp        

>NTDB_id=844471 QLQ02_RS16085 WP_286058320.1 3110873..3111280(+) (comGF) [Bacillus mojavensis strain KRS009]
GTGCTATTTTCGCTTTCTGCTTATTTGCTCATATCAGGATCGTTAGCGATGTTCTTTCATCTATTTTTGGCACGTCAACA
GGAGAATGAGGGCTTCATGCAGCGAGAATGGATCATTTCGGTAGAGCAGATCATGAATGAGTGCAAGCAGTCGCAGACTG
TGCAGACAGCTGAGCATGGCAGCGTCTTAATCTGCAGAAATCTGTCTGGGCAAGAGGTCCGTTTTGAAATCTACCATTCA
ATGATCAGGAAAAGAGTAGACGGGAAAGGGCATGTTCCGATTCTTGGCCATATTAAAACAATGAAAGCAGAGGTTAGAAA
TGGGATGCTTTGGCTGAAAGTCAAGAGTGAGAATGATAAAGAGTATCAAACCGCTGTTCCGGTATATACGTCATTAGGTG
GTGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

71.654

94.074

0.674