Detailed information    

insolico Bioinformatically predicted

Overview

Name   comX   Type   Regulator
Locus tag   QLQ02_RS12030 Genome accession   NZ_CP127833
Coordinates   2387423..2387590 (+) Length   55 a.a.
NCBI ID   WP_044158946.1    Uniprot ID   -
Organism   Bacillus mojavensis strain KRS009     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context

Location: 2382423..2392590
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QLQ02_RS12005 - 2382573..2384042 (+) 1470 WP_010331697.1 nicotinate phosphoribosyltransferase -
  QLQ02_RS12010 - 2384178..2385407 (+) 1230 WP_168748643.1 EAL and HDOD domain-containing protein -
  QLQ02_RS12015 - 2385383..2385751 (-) 369 WP_268447270.1 hypothetical protein -
  QLQ02_RS12020 degQ 2386212..2386352 (+) 141 WP_286058042.1 degradation enzyme regulation protein DegQ Regulator
  QLQ02_RS12025 comQ 2386537..2387439 (+) 903 WP_286059841.1 polyprenyl synthetase family protein Regulator
  QLQ02_RS12030 comX 2387423..2387590 (+) 168 WP_044158946.1 competence pheromone ComX Regulator
  QLQ02_RS12035 comP 2387606..2389915 (+) 2310 WP_286059843.1 two-component system sensor histidine kinase ComP Regulator
  QLQ02_RS12040 comA 2389996..2390640 (+) 645 WP_010331690.1 two-component system response regulator ComA Regulator
  QLQ02_RS12045 - 2390658..2391038 (+) 381 WP_229149090.1 hotdog fold thioesterase -
  QLQ02_RS12050 mnhG 2391077..2391451 (-) 375 WP_010331688.1 monovalent cation/H(+) antiporter subunit G -
  QLQ02_RS12055 - 2391435..2391719 (-) 285 WP_286058043.1 Na(+)/H(+) antiporter subunit F1 -
  QLQ02_RS12060 - 2391719..2392195 (-) 477 WP_010331686.1 Na+/H+ antiporter subunit E -

Sequence

Protein


Download         Length: 55 a.a.        Molecular weight: 6445.24 Da        Isoelectric Point: 4.5844

>NTDB_id=844450 QLQ02_RS12030 WP_044158946.1 2387423..2387590(+) (comX) [Bacillus mojavensis strain KRS009]
MQDLINYFLSYPEVLKKLKNREACLIGFSSDETETIIKAYNDYHLSSPTTREWDG

Nucleotide


Download         Length: 168 bp        

>NTDB_id=844450 QLQ02_RS12030 WP_044158946.1 2387423..2387590(+) (comX) [Bacillus mojavensis strain KRS009]
ATGCAAGACCTAATTAACTACTTTTTAAGTTATCCTGAGGTTTTAAAAAAATTGAAAAATAGAGAAGCTTGTCTTATAGG
TTTTAGTTCAGACGAAACTGAAACAATAATTAAAGCTTACAATGATTATCATCTGTCTAGCCCAACAACCCGTGAATGGG
ATGGTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

79.245

96.364

0.764