Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   QLQ02_RS12020 Genome accession   NZ_CP127833
Coordinates   2386212..2386352 (+) Length   46 a.a.
NCBI ID   WP_286058042.1    Uniprot ID   -
Organism   Bacillus mojavensis strain KRS009     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2381212..2391352
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QLQ02_RS11995 - 2381511..2381909 (+) 399 WP_168748645.1 DUF1694 domain-containing protein -
  QLQ02_RS12000 - 2382006..2382557 (+) 552 WP_168748644.1 isochorismatase family cysteine hydrolase -
  QLQ02_RS12005 - 2382573..2384042 (+) 1470 WP_010331697.1 nicotinate phosphoribosyltransferase -
  QLQ02_RS12010 - 2384178..2385407 (+) 1230 WP_168748643.1 EAL and HDOD domain-containing protein -
  QLQ02_RS12015 - 2385383..2385751 (-) 369 WP_268447270.1 hypothetical protein -
  QLQ02_RS12020 degQ 2386212..2386352 (+) 141 WP_286058042.1 degradation enzyme regulation protein DegQ Regulator
  QLQ02_RS12025 comQ 2386537..2387439 (+) 903 WP_286059841.1 polyprenyl synthetase family protein Regulator
  QLQ02_RS12030 comX 2387423..2387590 (+) 168 WP_044158946.1 competence pheromone ComX Regulator
  QLQ02_RS12035 comP 2387606..2389915 (+) 2310 WP_286059843.1 two-component system sensor histidine kinase ComP Regulator
  QLQ02_RS12040 comA 2389996..2390640 (+) 645 WP_010331690.1 two-component system response regulator ComA Regulator
  QLQ02_RS12045 - 2390658..2391038 (+) 381 WP_229149090.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5489.38 Da        Isoelectric Point: 4.9432

>NTDB_id=844448 QLQ02_RS12020 WP_286058042.1 2386212..2386352(+) (degQ) [Bacillus mojavensis strain KRS009]
MEKKLEEVKQLLFRLELDIKETTDSLQNINKSIDQLDKFTYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=844448 QLQ02_RS12020 WP_286058042.1 2386212..2386352(+) (degQ) [Bacillus mojavensis strain KRS009]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACA
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCACATACGCAATGAAAATTTCGTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

93.478

100

0.935