Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   QQS39_RS07140 Genome accession   NZ_CP127389
Coordinates   1559050..1559547 (-) Length   165 a.a.
NCBI ID   WP_285805633.1    Uniprot ID   -
Organism   Proteus appendicitidis strain HZ0627     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1554572..1604547 1559050..1559547 within 0


Gene organization within MGE regions


Location: 1554572..1604547
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QQS39_RS07115 (QQS39_07115) rluE 1554572..1555201 (-) 630 WP_285805631.1 23S rRNA pseudouridine(2457) synthase RluE -
  QQS39_RS07120 (QQS39_07120) icd 1555340..1556593 (+) 1254 WP_151434827.1 NADP-dependent isocitrate dehydrogenase -
  QQS39_RS07125 (QQS39_07125) - 1556714..1557841 (-) 1128 WP_196571483.1 site-specific integrase -
  QQS39_RS07130 (QQS39_07130) - 1557822..1558064 (-) 243 WP_036894694.1 excisionase -
  QQS39_RS07135 (QQS39_07135) - 1558157..1558798 (-) 642 WP_285805632.1 hypothetical protein -
  QQS39_RS07140 (QQS39_07140) ssb 1559050..1559547 (-) 498 WP_285805633.1 single-stranded DNA-binding protein Machinery gene
  QQS39_RS07145 (QQS39_07145) - 1559540..1560073 (-) 534 WP_285805634.1 HD family hydrolase -
  QQS39_RS07150 (QQS39_07150) - 1560259..1560753 (+) 495 WP_109372913.1 hypothetical protein -
  QQS39_RS07155 (QQS39_07155) - 1561126..1561815 (-) 690 WP_109850091.1 helix-turn-helix transcriptional regulator -
  QQS39_RS07160 (QQS39_07160) - 1561913..1562128 (+) 216 WP_206449794.1 helix-turn-helix transcriptional regulator -
  QQS39_RS07165 (QQS39_07165) - 1562185..1562643 (+) 459 WP_109850089.1 YmfL family putative regulatory protein -
  QQS39_RS07170 (QQS39_07170) - 1562732..1562941 (+) 210 WP_098943307.1 hypothetical protein -
  QQS39_RS07175 (QQS39_07175) - 1562931..1563110 (+) 180 WP_099659597.1 DUF4222 domain-containing protein -
  QQS39_RS07180 (QQS39_07180) - 1563123..1564214 (+) 1092 WP_285805635.1 replication protein -
  QQS39_RS07185 (QQS39_07185) - 1564287..1564673 (+) 387 WP_285805636.1 RusA family crossover junction endodeoxyribonuclease -
  QQS39_RS07190 (QQS39_07190) - 1564691..1564891 (+) 201 WP_285805637.1 hypothetical protein -
  QQS39_RS07195 (QQS39_07195) - 1564888..1565913 (+) 1026 WP_285805638.1 DUF968 domain-containing protein -
  QQS39_RS07200 (QQS39_07200) - 1565942..1566337 (+) 396 WP_285805639.1 antiterminator Q family protein -
  QQS39_RS07205 (QQS39_07205) - 1567312..1567488 (+) 177 WP_231310469.1 hypothetical protein -
  QQS39_RS07210 (QQS39_07210) - 1567562..1568584 (+) 1023 WP_285805640.1 site-specific DNA-methyltransferase -
  QQS39_RS07215 (QQS39_07215) - 1568780..1569370 (+) 591 WP_109400951.1 hypothetical protein -
  QQS39_RS07220 (QQS39_07220) - 1569456..1569668 (-) 213 WP_109400952.1 hypothetical protein -
  QQS39_RS07225 (QQS39_07225) - 1569809..1570078 (+) 270 WP_004250558.1 hypothetical protein -
  QQS39_RS07230 (QQS39_07230) - 1570078..1570548 (+) 471 WP_285805641.1 lysozyme -
  QQS39_RS07235 (QQS39_07235) - 1570530..1570688 (+) 159 WP_285805642.1 hypothetical protein -
  QQS39_RS07240 (QQS39_07240) - 1570691..1571155 (+) 465 WP_285805643.1 lysis protein -
  QQS39_RS07245 (QQS39_07245) - 1571702..1572013 (+) 312 WP_285805644.1 hypothetical protein -
  QQS39_RS07250 (QQS39_07250) - 1572072..1572419 (+) 348 WP_285805645.1 HNH endonuclease signature motif containing protein -
  QQS39_RS07255 (QQS39_07255) - 1572633..1573103 (+) 471 WP_285805646.1 phage terminase small subunit P27 family -
  QQS39_RS07260 (QQS39_07260) - 1573107..1574840 (+) 1734 WP_285805647.1 terminase TerL endonuclease subunit -
  QQS39_RS07265 (QQS39_07265) - 1574850..1575029 (+) 180 WP_088495902.1 hypothetical protein -
  QQS39_RS07270 (QQS39_07270) - 1575029..1576258 (+) 1230 WP_023582514.1 phage portal protein -
  QQS39_RS07275 (QQS39_07275) - 1576236..1576880 (+) 645 WP_285805881.1 HK97 family phage prohead protease -
  QQS39_RS07280 (QQS39_07280) - 1576894..1578102 (+) 1209 WP_248620128.1 phage major capsid protein -
  QQS39_RS07285 (QQS39_07285) - 1578198..1578506 (+) 309 WP_100159853.1 head-tail connector protein -
  QQS39_RS07290 (QQS39_07290) - 1578503..1578826 (+) 324 WP_248620129.1 phage head closure protein -
  QQS39_RS07295 (QQS39_07295) - 1578823..1579263 (+) 441 WP_198813431.1 HK97-gp10 family putative phage morphogenesis protein -
  QQS39_RS07300 (QQS39_07300) - 1579260..1579595 (+) 336 WP_161769481.1 hypothetical protein -
  QQS39_RS07305 (QQS39_07305) - 1579661..1580128 (+) 468 WP_036913331.1 phage tail tube protein -
  QQS39_RS07310 (QQS39_07310) - 1580131..1580511 (+) 381 WP_088495895.1 phage tail assembly chaperone -
  QQS39_RS07315 (QQS39_07315) - 1580553..1580816 (+) 264 WP_227335946.1 DUF4035 domain-containing protein -
  QQS39_RS07320 (QQS39_07320) - 1580836..1584102 (+) 3267 WP_285805648.1 phage tail tape measure protein -
  QQS39_RS07325 (QQS39_07325) - 1584105..1584437 (+) 333 WP_248620134.1 phage tail protein -
  QQS39_RS07330 (QQS39_07330) - 1584431..1585183 (+) 753 WP_248620136.1 phage minor tail protein L -
  QQS39_RS07335 (QQS39_07335) - 1585189..1585896 (+) 708 WP_285805882.1 C40 family peptidase -
  QQS39_RS07340 (QQS39_07340) - 1585987..1586487 (+) 501 WP_023582500.1 hypothetical protein -
  QQS39_RS07345 (QQS39_07345) - 1586544..1587137 (+) 594 WP_023582499.1 tail assembly protein -
  QQS39_RS07350 (QQS39_07350) - 1587157..1590888 (+) 3732 WP_285805649.1 phage tail protein -
  QQS39_RS07355 (QQS39_07355) - 1590900..1592639 (+) 1740 WP_285805650.1 hypothetical protein -
  QQS39_RS07360 (QQS39_07360) - 1592840..1593886 (+) 1047 WP_049210459.1 DUF3800 domain-containing protein -
  QQS39_RS07365 (QQS39_07365) - 1594841..1595563 (+) 723 WP_285805651.1 hypothetical protein -
  QQS39_RS07370 (QQS39_07370) - 1596101..1596268 (+) 168 Protein_1419 isocitrate/isopropylmalate family dehydrogenase -
  QQS39_RS07375 (QQS39_07375) tnpA 1596474..1596929 (+) 456 WP_285805652.1 IS200/IS605 family transposase -
  QQS39_RS07380 (QQS39_07380) - 1597104..1598235 (-) 1132 Protein_1421 site-specific integrase -
  QQS39_RS07385 (QQS39_07385) - 1598472..1598993 (+) 522 WP_072062621.1 DUF1440 domain-containing protein -
  QQS39_RS07390 (QQS39_07390) - 1599143..1599337 (+) 195 WP_285805653.1 hypothetical protein -
  QQS39_RS07395 (QQS39_07395) - 1599411..1600425 (+) 1015 Protein_1424 site-specific DNA-methyltransferase -
  QQS39_RS07400 (QQS39_07400) - 1600507..1600863 (+) 357 WP_285805654.1 MmcQ/YjbR family DNA-binding protein -
  QQS39_RS07405 (QQS39_07405) - 1601149..1601334 (-) 186 WP_285805655.1 hypothetical protein -
  QQS39_RS07410 (QQS39_07410) - 1601437..1601706 (+) 270 WP_151434890.1 hypothetical protein -
  QQS39_RS07415 (QQS39_07415) - 1601706..1602176 (+) 471 WP_151434891.1 lysozyme -
  QQS39_RS07420 (QQS39_07420) - 1602158..1602316 (+) 159 WP_285805656.1 hypothetical protein -
  QQS39_RS07425 (QQS39_07425) - 1602327..1603151 (+) 825 WP_285805657.1 colicin-like pore-forming protein -
  QQS39_RS07430 (QQS39_07430) - 1603178..1603513 (-) 336 WP_285805658.1 colicin E1 family microcin immunity protein -
  QQS39_RS07435 (QQS39_07435) - 1603746..1603889 (+) 144 WP_285805913.1 hypothetical protein -

Sequence


Protein


Download         Length: 165 a.a.        Molecular weight: 18022.52 Da        Isoelectric Point: 8.0311

>NTDB_id=843976 QQS39_RS07140 WP_285805633.1 1559050..1559547(-) (ssb) [Proteus appendicitidis strain HZ0627]
MANGSVNKVILIGNLGRDPEIRYLPSGGAVANLAVATSEKWRDKQTGENREKTEWHRVVLFGKLADIASGYLCKGSQIYI
EGQLQTREWDDNGVKRYTTEIVVKVGGSMQMLGGASKSVGSQPAQQSLPPAQSQAKSNKPPMDFEDDIPFAPIGLMYPHH
LINVI

Nucleotide


Download         Length: 498 bp        

>NTDB_id=843976 QQS39_RS07140 WP_285805633.1 1559050..1559547(-) (ssb) [Proteus appendicitidis strain HZ0627]
ATGGCTAACGGATCAGTAAACAAAGTAATTCTTATCGGCAATTTAGGTCGTGATCCTGAAATTCGTTATCTTCCCTCTGG
TGGTGCTGTTGCCAATTTAGCTGTGGCCACAAGTGAAAAATGGCGTGATAAACAAACGGGTGAAAACCGCGAAAAAACAG
AATGGCATCGTGTTGTTTTGTTTGGAAAACTTGCAGATATCGCCAGTGGCTATTTGTGCAAAGGCTCTCAAATTTATATT
GAGGGCCAACTACAAACACGCGAATGGGATGATAACGGTGTTAAACGCTATACAACTGAAATTGTTGTAAAAGTTGGTGG
TTCGATGCAGATGCTAGGTGGCGCTAGTAAATCAGTAGGTTCACAACCGGCACAGCAAAGCCTGCCACCAGCTCAATCTC
AAGCCAAAAGCAATAAGCCACCAATGGATTTTGAGGATGATATTCCCTTCGCACCGATTGGGCTTATGTATCCGCACCAT
TTAATTAACGTGATTTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

57.627

100

0.618

  ssb Glaesserella parasuis strain SC1401

47.778

100

0.521

  ssb Neisseria meningitidis MC58

41.243

100

0.442

  ssb Neisseria gonorrhoeae MS11

41.243

100

0.442