Detailed information    

insolico Bioinformatically predicted

Overview


Name   mecA   Type   Regulator
Locus tag   LLC_RS11330 Genome accession   NZ_AP024222
Coordinates   2218958..2219659 (+) Length   233 a.a.
NCBI ID   WP_011676802.1    Uniprot ID   A0A0M2ZUZ8
Organism   Lactococcus cremoris strain EPSC     
Function   degradation of ComX (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 2203963..2283334 2218958..2219659 within 0


Gene organization within MGE regions


Location: 2203963..2283334
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LLC_RS11290 (LLC_23280) - 2205437..2206975 (-) 1539 Protein_2232 M13-type metalloendopeptidase -
  LLC_RS11295 (LLC_23290) - 2207132..2207806 (-) 675 WP_015082761.1 helix-turn-helix domain-containing protein -
  LLC_RS11300 (LLC_23300) - 2208042..2208641 (+) 600 WP_011676808.1 transcriptional regulator -
  LLC_RS11305 (LLC_23310) rpoB 2208910..2212500 (+) 3591 WP_126354712.1 DNA-directed RNA polymerase subunit beta -
  LLC_RS11310 (LLC_23320) rpoC 2212608..2216231 (+) 3624 WP_164717651.1 DNA-directed RNA polymerase subunit beta' -
  LLC_RS11315 (LLC_23330) - 2216412..2217263 (+) 852 WP_308167263.1 diacylglycerol/lipid kinase family protein -
  LLC_RS11320 (LLC_23340) - 2217409..2218095 (+) 687 WP_014572148.1 amino acid ABC transporter permease -
  LLC_RS11325 (LLC_23350) - 2218095..2218829 (+) 735 WP_011676803.1 amino acid ABC transporter ATP-binding protein -
  LLC_RS11330 (LLC_23360) mecA 2218958..2219659 (+) 702 WP_011676802.1 adaptor protein MecA Regulator
  LLC_RS11335 (LLC_23370) - 2219662..2220987 (+) 1326 WP_126354714.1 glycosyltransferase family 4 protein -
  LLC_RS11340 (LLC_23380) sufC 2221163..2221933 (+) 771 WP_011676800.1 Fe-S cluster assembly ATPase SufC -
  LLC_RS11345 (LLC_23390) sufD 2222073..2223329 (+) 1257 WP_021165660.1 Fe-S cluster assembly protein SufD -
  LLC_RS11350 (LLC_23400) - 2223329..2224549 (+) 1221 WP_021213770.1 cysteine desulfurase -
  LLC_RS11355 (LLC_23410) - 2224551..2225033 (+) 483 WP_031286519.1 hypothetical protein -
  LLC_RS11360 (LLC_23420) sufU 2225167..2225625 (+) 459 WP_011676796.1 Fe-S cluster assembly sulfur transfer protein SufU -
  LLC_RS11365 (LLC_23430) sufB 2225721..2227133 (+) 1413 WP_004255207.1 Fe-S cluster assembly protein SufB -
  LLC_RS11370 (LLC_23440) - 2227480..2227770 (+) 291 WP_011676794.1 WXG100 family type VII secretion target -
  LLC_RS11375 (LLC_23450) essA 2227878..2228348 (+) 471 WP_011835707.1 type VII secretion protein EssA -
  LLC_RS11380 (LLC_23460) - 2228470..2228715 (+) 246 WP_021165657.1 hypothetical protein -
  LLC_RS11385 (LLC_23470) esaA 2228778..2230778 (+) 2001 WP_061777933.1 type VII secretion protein EsaA -
  LLC_RS11390 (LLC_23480) - 2230779..2231669 (-) 891 WP_061777934.1 IS982 family transposase -
  LLC_RS11395 (LLC_23490) - 2231880..2232449 (+) 570 WP_011676781.1 biotin transporter BioY -
  LLC_RS11400 (LLC_23500) - 2232455..2233426 (+) 972 WP_015082750.1 biotin--[acetyl-CoA-carboxylase] ligase -
  LLC_RS11405 (LLC_23510) - 2233447..2233749 (+) 303 WP_011676779.1 CHY zinc finger protein -
  LLC_RS11410 (LLC_23520) tenA 2233968..2234624 (+) 657 WP_011835701.1 thiaminase II -
  LLC_RS11415 (LLC_23530) - 2235012..2236190 (+) 1179 WP_011676777.1 SLC13 family permease -
  LLC_RS11420 (LLC_23540) - 2236363..2236923 (+) 561 WP_032950467.1 GNAT family N-acetyltransferase -
  LLC_RS11425 - 2237039..2237437 (+) 399 WP_061777935.1 hypothetical protein -
  LLC_RS11430 (LLC_23550) - 2237543..2238475 (+) 933 WP_014572202.1 ABC transporter ATP-binding protein -
  LLC_RS11435 (LLC_23560) - 2238472..2239833 (+) 1362 WP_061777936.1 ABC transporter permease -
  LLC_RS11440 (LLC_23570) comEA 2239964..2240446 (+) 483 WP_232035111.1 SLBB domain-containing protein Machinery gene
  LLC_RS14370 comEA 2240443..2240544 (+) 102 WP_228764031.1 ComEA family DNA-binding protein Machinery gene
  LLC_RS11445 (LLC_23580) comEC 2240672..2241943 (+) 1272 WP_324187043.1 ComEC/Rec2 family competence protein Machinery gene
  LLC_RS14375 (LLC_23590) comEC 2241940..2242449 (+) 510 WP_232035112.1 MBL fold metallo-hydrolase Machinery gene
  LLC_RS11450 (LLC_23600) - 2242526..2243416 (+) 891 WP_126354716.1 IS982-like element IS982B family transposase -
  LLC_RS11455 (LLC_23610) - 2243437..2243742 (+) 306 Protein_2267 ComEC/Rec2 family competence protein -
  LLC_RS11460 (LLC_23620) - 2244026..2244802 (+) 777 WP_061778314.1 alpha/beta hydrolase -
  LLC_RS11465 (LLC_23630) - 2244985..2245200 (+) 216 WP_014572212.1 F0F1 ATP synthase subunit C -
  LLC_RS11470 (LLC_23640) atpB 2245247..2245960 (+) 714 WP_004255255.1 F0F1 ATP synthase subunit A -
  LLC_RS11475 (LLC_23650) atpF 2245975..2246481 (+) 507 WP_010906128.1 F0F1 ATP synthase subunit B -
  LLC_RS11480 (LLC_23660) - 2246483..2247010 (+) 528 WP_014572213.1 F0F1 ATP synthase subunit delta -
  LLC_RS11485 (LLC_23670) atpA 2247198..2248700 (+) 1503 WP_061778315.1 F0F1 ATP synthase subunit alpha -
  LLC_RS11490 (LLC_23680) - 2248716..2249585 (+) 870 WP_021165644.1 F0F1 ATP synthase subunit gamma -
  LLC_RS11495 (LLC_23690) atpD 2249757..2251166 (+) 1410 WP_021165643.1 F0F1 ATP synthase subunit beta -
  LLC_RS11500 (LLC_23700) - 2251351..2251776 (+) 426 WP_011676764.1 F0F1 ATP synthase subunit epsilon -
  LLC_RS11505 (LLC_23710) - 2251880..2252539 (+) 660 WP_231099776.1 hypothetical protein -
  LLC_RS11510 (LLC_23720) - 2252540..2253067 (+) 528 WP_232035113.1 hypothetical protein -
  LLC_RS14380 (LLC_23730) - 2253080..2253478 (+) 399 WP_232035114.1 hypothetical protein -
  LLC_RS11515 (LLC_23750) - 2253515..2254626 (+) 1112 WP_126354718.1 IS3-like element IS981 family transposase -
  LLC_RS11520 (LLC_23760) - 2254719..2254931 (+) 213 WP_234922798.1 hypothetical protein -
  LLC_RS11525 (LLC_23770) - 2255039..2255587 (+) 549 WP_061777789.1 hypothetical protein -
  LLC_RS11530 (LLC_23780) - 2255644..2256387 (-) 744 WP_011676756.1 amino acid ABC transporter ATP-binding protein -
  LLC_RS11535 (LLC_23790) - 2256410..2258554 (-) 2145 WP_011676755.1 amino acid ABC transporter substrate-binding protein/permease -
  LLC_RS11540 (LLC_23800) - 2258923..2259579 (+) 657 WP_014572220.1 VTT domain-containing protein -
  LLC_RS11545 (LLC_23810) - 2259757..2260617 (+) 861 WP_021165626.1 shikimate dehydrogenase -
  LLC_RS11550 (LLC_23820) aroB 2260614..2261684 (+) 1071 WP_061777788.1 3-dehydroquinate synthase -
  LLC_RS11555 (LLC_23830) - 2261798..2262721 (+) 924 WP_061777787.1 DMT family transporter -
  LLC_RS11560 (LLC_23840) - 2263093..2263692 (+) 600 WP_014572223.1 DUF1054 domain-containing protein -
  LLC_RS11565 (LLC_23850) - 2263697..2264293 (+) 597 WP_021165625.1 HAD-IA family hydrolase -
  LLC_RS11570 (LLC_23860) aroC 2264324..2265490 (+) 1167 WP_011676748.1 chorismate synthase -
  LLC_RS11575 (LLC_23870) - 2265612..2265968 (+) 357 WP_061777786.1 YxeA family protein -
  LLC_RS11580 (LLC_23890) - 2266163..2266942 (+) 780 WP_021165624.1 ABC transporter ATP-binding protein -
  LLC_RS11585 (LLC_23900) - 2266935..2268944 (+) 2010 WP_032950486.1 ABC transporter permease -
  LLC_RS11590 (LLC_23910) - 2268965..2269912 (-) 948 WP_003130410.1 IS30 family transposase -
  LLC_RS11595 (LLC_23920) - 2270211..2271275 (+) 1065 WP_011676743.1 VanZ family protein -
  LLC_RS11600 (LLC_23930) - 2271278..2271949 (+) 672 WP_021165622.1 response regulator transcription factor -
  LLC_RS14610 - 2271936..2272810 (+) 875 Protein_2298 sensor histidine kinase -
  LLC_RS11610 (LLC_23960) - 2272814..2273878 (+) 1065 WP_011676740.1 prephenate dehydrogenase -
  LLC_RS11615 (LLC_23970) aroA 2273999..2275291 (+) 1293 WP_126354722.1 3-phosphoshikimate 1-carboxyvinyltransferase -
  LLC_RS11620 (LLC_23980) - 2275315..2275803 (+) 489 WP_011676738.1 shikimate kinase -
  LLC_RS11625 (LLC_23990) pheA 2275805..2276644 (+) 840 WP_011676737.1 prephenate dehydratase -
  LLC_RS11630 (LLC_24000) - 2276647..2277240 (+) 594 WP_061777784.1 histidine phosphatase family protein -
  LLC_RS11635 (LLC_24010) - 2277237..2279738 (+) 2502 WP_126354724.1 ATP-dependent RecD-like DNA helicase -
  LLC_RS11640 (LLC_24020) rpsT 2279832..2280065 (-) 234 WP_011676734.1 30S ribosomal protein S20 -
  LLC_RS11645 (LLC_24030) - 2280395..2280907 (+) 513 WP_061777782.1 HD domain-containing protein -
  LLC_RS11650 (LLC_24040) - 2281087..2282001 (+) 915 WP_011676732.1 diacylglycerol/lipid kinase family protein -
  LLC_RS11655 (LLC_24050) - 2282123..2283334 (-) 1212 WP_126354726.1 tyrosine-type recombinase/integrase -

Sequence


Protein


Download         Length: 233 a.a.        Molecular weight: 27046.46 Da        Isoelectric Point: 4.1802

>NTDB_id=84153 LLC_RS11330 WP_011676802.1 2218958..2219659(+) (mecA) [Lactococcus cremoris strain EPSC]
MKYEDINENTIKITLSFDDLTDYDIKLSDFFGNQEVIEQFFYELVDELGLENRFGNVGMLTFQIQPFPQGVHMIVHEEAM
LGEGGEIPDDPEEFEELMTGFYNKLNEIGADMARERGITDFKPGLGLPGAKKEEAEHEPDFIYYSIRYDDMMSVLTGIKN
VKFADEESEFYRYDGNFYLVVLDNQKAKGKMHVESTRSRMMEYGEATKMSREFLQEYGECLITTRALDVLRKI

Nucleotide


Download         Length: 702 bp        

>NTDB_id=84153 LLC_RS11330 WP_011676802.1 2218958..2219659(+) (mecA) [Lactococcus cremoris strain EPSC]
ATGAAGTATGAGGATATAAATGAAAACACTATAAAAATCACCTTGTCTTTTGATGATTTGACAGATTATGATATCAAGTT
ATCTGACTTTTTTGGAAATCAAGAAGTCATTGAACAATTTTTCTATGAATTAGTTGATGAACTTGGCTTAGAAAATCGTT
TTGGAAATGTAGGGATGTTAACTTTCCAAATTCAACCCTTCCCACAAGGCGTCCATATGATTGTTCATGAAGAAGCAATG
TTGGGTGAAGGCGGAGAGATTCCAGATGATCCTGAAGAATTTGAAGAATTAATGACTGGTTTTTATAATAAATTAAATGA
AATAGGGGCAGATATGGCGCGCGAGCGAGGAATTACTGATTTTAAACCTGGACTTGGTTTACCAGGGGCTAAAAAAGAAG
AAGCCGAACATGAGCCAGACTTTATATACTACTCTATTCGTTATGATGACATGATGTCTGTCTTGACTGGAATAAAAAAT
GTGAAATTCGCAGATGAAGAGTCAGAATTTTATCGTTATGATGGTAATTTTTATCTTGTTGTTTTAGATAATCAAAAAGC
AAAAGGTAAAATGCATGTTGAAAGCACACGTTCACGGATGATGGAATATGGTGAAGCGACAAAAATGAGTCGAGAATTTT
TGCAGGAGTATGGTGAATGCCTAATCACAACGCGTGCTTTAGACGTTCTTAGAAAAATCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A0M2ZUZ8

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  mecA Lactococcus lactis subsp. cremoris KW2

100

100

1

  mecA Lactococcus lactis subsp. lactis strain DGCC12653

96.567

100

0.966


Multiple sequence alignment