Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | LLC_RS08985 | Genome accession | NZ_AP024222 |
| Coordinates | 1764523..1765023 (+) | Length | 166 a.a. |
| NCBI ID | WP_011677241.1 | Uniprot ID | A0A0M2ZSZ2 |
| Organism | Lactococcus cremoris strain EPSC | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1733594..1768898 | 1764523..1765023 | within | 0 |
Gene organization within MGE regions
Location: 1733594..1768898
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLC_RS08795 (LLC_18150) | - | 1733594..1733941 (+) | 348 | WP_011677259.1 | RicAFT regulatory complex protein RicA family protein | - |
| LLC_RS08800 (LLC_18160) | mutS | 1734057..1736579 (+) | 2523 | WP_021164823.1 | DNA mismatch repair protein MutS | - |
| LLC_RS08805 (LLC_18170) | - | 1736689..1737384 (+) | 696 | WP_061777695.1 | hypothetical protein | - |
| LLC_RS08810 (LLC_18180) | mutL | 1737514..1739484 (+) | 1971 | WP_011677256.1 | DNA mismatch repair endonuclease MutL | - |
| LLC_RS08815 (LLC_18190) | ruvA | 1739536..1740129 (+) | 594 | WP_011677255.1 | Holliday junction branch migration protein RuvA | - |
| LLC_RS08820 (LLC_18200) | ruvB | 1740277..1741278 (+) | 1002 | WP_061777694.1 | Holliday junction branch migration DNA helicase RuvB | - |
| LLC_RS08825 (LLC_18210) | - | 1741423..1741860 (+) | 438 | WP_061777693.1 | low molecular weight protein-tyrosine-phosphatase | - |
| LLC_RS08830 (LLC_18220) | - | 1741961..1742326 (+) | 366 | WP_011836114.1 | MerR family transcriptional regulator | - |
| LLC_RS08835 (LLC_18230) | glnA | 1742388..1743728 (+) | 1341 | WP_061777692.1 | type I glutamate--ammonia ligase | - |
| LLC_RS08840 (LLC_18240) | - | 1743789..1743989 (-) | 201 | WP_021164829.1 | hypothetical protein | - |
| LLC_RS08845 (LLC_18250) | - | 1744729..1745454 (-) | 726 | WP_126354613.1 | hypothetical protein | - |
| LLC_RS08850 (LLC_18260) | - | 1745447..1746769 (-) | 1323 | WP_011835935.1 | AAA family ATPase | - |
| LLC_RS08855 (LLC_18270) | - | 1747216..1747548 (-) | 333 | WP_011835936.1 | hypothetical protein | - |
| LLC_RS08860 (LLC_18280) | - | 1747548..1747988 (-) | 441 | WP_126354615.1 | terminase small subunit | - |
| LLC_RS08865 (LLC_18290) | - | 1748109..1748690 (-) | 582 | WP_126354617.1 | hypothetical protein | - |
| LLC_RS08870 (LLC_18300) | - | 1749153..1750826 (-) | 1674 | WP_126354619.1 | hypothetical protein | - |
| LLC_RS08875 (LLC_18310) | - | 1750935..1751264 (-) | 330 | WP_021212130.1 | hypothetical protein | - |
| LLC_RS08880 (LLC_18320) | - | 1751251..1751445 (-) | 195 | WP_126354621.1 | hypothetical protein | - |
| LLC_RS14245 (LLC_18330) | - | 1751442..1751696 (-) | 255 | WP_126354623.1 | hypothetical protein | - |
| LLC_RS08885 (LLC_18340) | - | 1751693..1751932 (-) | 240 | WP_126354624.1 | hypothetical protein | - |
| LLC_RS08890 (LLC_18350) | - | 1751969..1752250 (-) | 282 | WP_126354626.1 | hypothetical protein | - |
| LLC_RS08895 (LLC_18360) | - | 1752243..1752479 (-) | 237 | WP_126354628.1 | hypothetical protein | - |
| LLC_RS08900 (LLC_18370) | - | 1752476..1752997 (-) | 522 | WP_126354630.1 | hypothetical protein | - |
| LLC_RS08905 (LLC_18380) | - | 1753001..1753195 (-) | 195 | WP_032951169.1 | DUF1655 domain-containing protein | - |
| LLC_RS08910 (LLC_18390) | - | 1753314..1753499 (-) | 186 | WP_063282780.1 | helix-turn-helix domain-containing protein | - |
| LLC_RS08915 (LLC_18400) | - | 1753582..1753908 (+) | 327 | WP_063282781.1 | hypothetical protein | - |
| LLC_RS08920 (LLC_18410) | - | 1753984..1754232 (-) | 249 | WP_126354632.1 | hypothetical protein | - |
| LLC_RS08925 (LLC_18420) | - | 1754236..1754433 (-) | 198 | WP_014573247.1 | hypothetical protein | - |
| LLC_RS08930 (LLC_18430) | - | 1754693..1755079 (+) | 387 | WP_126354634.1 | helix-turn-helix domain-containing protein | - |
| LLC_RS08935 (LLC_18440) | - | 1755089..1755628 (+) | 540 | WP_126354636.1 | hypothetical protein | - |
| LLC_RS08940 (LLC_18450) | - | 1755949..1757133 (+) | 1185 | WP_126354638.1 | tyrosine-type recombinase/integrase | - |
| LLC_RS08945 (LLC_18460) | - | 1757423..1757872 (+) | 450 | WP_011677249.1 | hypothetical protein | - |
| LLC_RS08950 (LLC_18470) | - | 1757906..1758178 (-) | 273 | WP_011677248.1 | chorismate mutase | - |
| LLC_RS08955 (LLC_18480) | - | 1758262..1758750 (+) | 489 | WP_011677247.1 | GAF domain-containing protein | - |
| LLC_RS08960 (LLC_18490) | - | 1758782..1759423 (+) | 642 | WP_011677246.1 | phosphotransferase | - |
| LLC_RS08965 (LLC_18500) | dnaX | 1759469..1761130 (+) | 1662 | WP_011677245.1 | DNA polymerase III subunit gamma/tau | - |
| LLC_RS08970 (LLC_18510) | - | 1761164..1762630 (-) | 1467 | WP_021164830.1 | amino acid permease | - |
| LLC_RS08975 (LLC_18520) | - | 1763152..1764006 (+) | 855 | WP_021164831.1 | undecaprenyl-diphosphate phosphatase | - |
| LLC_RS08980 (LLC_18530) | rpsF | 1764200..1764493 (+) | 294 | WP_011677242.1 | 30S ribosomal protein S6 | - |
| LLC_RS08985 (LLC_18540) | ssb | 1764523..1765023 (+) | 501 | WP_011677241.1 | single-stranded DNA-binding protein | Machinery gene |
| LLC_RS08990 (LLC_18550) | rpsR | 1765195..1765440 (+) | 246 | WP_003131952.1 | 30S ribosomal protein S18 | - |
| LLC_RS08995 (LLC_18560) | - | 1765571..1766356 (+) | 786 | WP_021164832.1 | metallophosphoesterase | - |
| LLC_RS09000 (LLC_18570) | - | 1766429..1766737 (-) | 309 | WP_011836103.1 | DUF960 domain-containing protein | - |
| LLC_RS09005 (LLC_18580) | - | 1766776..1767624 (-) | 849 | WP_011677238.1 | MurR/RpiR family transcriptional regulator | - |
| LLC_RS09010 (LLC_18590) | gnd | 1767993..1768898 (+) | 906 | WP_011677237.1 | phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) | - |
Sequence
Protein
Download Length: 166 a.a. Molecular weight: 18233.05 Da Isoelectric Point: 5.2166
>NTDB_id=84136 LLC_RS08985 WP_011677241.1 1764523..1765023(+) (ssb) [Lactococcus cremoris strain EPSC]
MINNVVLVGRITRDPELRYTPQNQAVATFSLAVNRQFKNANGEREADFINCVIWRQQAENLANWAKKGALIGVTGRIQTR
NYENQQGQRVYVTEVVADSFQMLESRSARDGMGGGASAGSYSAPSQSTNNTPRPQTNNNSATPNFGRDADPFGSSPMEIS
DDDLPF
MINNVVLVGRITRDPELRYTPQNQAVATFSLAVNRQFKNANGEREADFINCVIWRQQAENLANWAKKGALIGVTGRIQTR
NYENQQGQRVYVTEVVADSFQMLESRSARDGMGGGASAGSYSAPSQSTNNTPRPQTNNNSATPNFGRDADPFGSSPMEIS
DDDLPF
Nucleotide
Download Length: 501 bp
>NTDB_id=84136 LLC_RS08985 WP_011677241.1 1764523..1765023(+) (ssb) [Lactococcus cremoris strain EPSC]
ATGATTAACAATGTTGTATTAGTGGGACGCATTACTCGCGATCCTGAACTTCGTTACACCCCTCAAAATCAAGCTGTTGC
TACTTTTTCATTGGCTGTAAATCGTCAATTTAAAAATGCTAACGGTGAACGTGAGGCTGATTTCATTAACTGCGTTATTT
GGCGCCAACAAGCTGAAAATTTGGCAAATTGGGCTAAAAAAGGAGCTTTGATCGGTGTAACTGGTCGAATTCAAACACGT
AATTATGAAAATCAACAAGGTCAACGCGTTTATGTGACTGAGGTTGTGGCTGATAGTTTCCAAATGTTGGAAAGTAGATC
TGCTCGCGATGGTATGGGAGGCGGAGCTTCTGCCGGTTCATATTCTGCACCAAGCCAATCTACAAATAATACTCCACGTC
CACAAACGAATAATAATAGTGCAACACCGAATTTCGGTCGTGATGCTGACCCATTTGGTAGCTCACCTATGGAAATCTCG
GATGATGACCTTCCATTCTAA
ATGATTAACAATGTTGTATTAGTGGGACGCATTACTCGCGATCCTGAACTTCGTTACACCCCTCAAAATCAAGCTGTTGC
TACTTTTTCATTGGCTGTAAATCGTCAATTTAAAAATGCTAACGGTGAACGTGAGGCTGATTTCATTAACTGCGTTATTT
GGCGCCAACAAGCTGAAAATTTGGCAAATTGGGCTAAAAAAGGAGCTTTGATCGGTGTAACTGGTCGAATTCAAACACGT
AATTATGAAAATCAACAAGGTCAACGCGTTTATGTGACTGAGGTTGTGGCTGATAGTTTCCAAATGTTGGAAAGTAGATC
TGCTCGCGATGGTATGGGAGGCGGAGCTTCTGCCGGTTCATATTCTGCACCAAGCCAATCTACAAATAATACTCCACGTC
CACAAACGAATAATAATAGTGCAACACCGAATTTCGGTCGTGATGCTGACCCATTTGGTAGCTCACCTATGGAAATCTCG
GATGATGACCTTCCATTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
59.884 |
100 |
0.62 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
56.395 |
100 |
0.584 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
63.855 |
0.373 |
| ssb | Glaesserella parasuis strain SC1401 |
33.898 |
100 |
0.361 |