Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | QQO08_RS01785 | Genome accession | NZ_CP127024 |
| Coordinates | 386197..386667 (+) | Length | 156 a.a. |
| NCBI ID | WP_000934759.1 | Uniprot ID | A0A2I7Y8V1 |
| Organism | Staphylococcus aureus strain CC239-MRSA-III(var.) isolate Trinidad&Tobago_2020-048_8421A | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 375611..418090 | 386197..386667 | within | 0 |
Gene organization within MGE regions
Location: 375611..418090
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQO08_RS01700 (QQO08_01700) | - | 375611..376816 (-) | 1206 | WP_000264186.1 | tyrosine-type recombinase/integrase | - |
| QQO08_RS01705 (QQO08_01705) | - | 376927..377106 (+) | 180 | WP_000337826.1 | hypothetical protein | - |
| QQO08_RS01710 (QQO08_01710) | - | 377086..378018 (-) | 933 | WP_000392181.1 | hypothetical protein | - |
| QQO08_RS01715 (QQO08_01715) | - | 378050..378775 (-) | 726 | WP_000661437.1 | PH domain-containing protein | - |
| QQO08_RS01720 (QQO08_01720) | - | 378803..379477 (-) | 675 | WP_000775187.1 | ImmA/IrrE family metallo-endopeptidase | - |
| QQO08_RS01725 (QQO08_01725) | - | 379494..379826 (-) | 333 | WP_001055143.1 | helix-turn-helix domain-containing protein | - |
| QQO08_RS01730 (QQO08_01730) | - | 380090..380284 (+) | 195 | WP_000108122.1 | helix-turn-helix domain-containing protein | - |
| QQO08_RS01735 (QQO08_01735) | - | 380284..381051 (+) | 768 | WP_001002757.1 | phage antirepressor Ant | - |
| QQO08_RS01740 (QQO08_01740) | tscA | 381052..381276 (+) | 225 | WP_000187184.1 | type II toxin-antitoxin system antitoxin TscA | - |
| QQO08_RS01745 (QQO08_01745) | - | 381316..381415 (+) | 100 | Protein_347 | hypothetical protein | - |
| QQO08_RS01750 (QQO08_01750) | - | 381564..381827 (+) | 264 | WP_001124198.1 | helix-turn-helix domain-containing protein | - |
| QQO08_RS01755 (QQO08_01755) | - | 381839..382000 (+) | 162 | WP_000066021.1 | DUF1270 family protein | - |
| QQO08_RS01760 (QQO08_01760) | - | 382092..382352 (+) | 261 | WP_000291089.1 | DUF1108 family protein | - |
| QQO08_RS01765 (QQO08_01765) | - | 382361..382624 (+) | 264 | WP_001205732.1 | hypothetical protein | - |
| QQO08_RS01770 (QQO08_01770) | - | 382633..384576 (+) | 1944 | WP_000700555.1 | AAA family ATPase | - |
| QQO08_RS01775 (QQO08_01775) | - | 384578..385498 (+) | 921 | WP_000180598.1 | recombinase RecT | - |
| QQO08_RS01780 (QQO08_01780) | - | 385579..386196 (+) | 618 | WP_064135358.1 | MBL fold metallo-hydrolase | - |
| QQO08_RS01785 (QQO08_01785) | ssbA | 386197..386667 (+) | 471 | WP_000934759.1 | single-stranded DNA-binding protein | Machinery gene |
| QQO08_RS01790 (QQO08_01790) | - | 386697..387590 (+) | 894 | WP_000148333.1 | DnaD domain protein | - |
| QQO08_RS01795 (QQO08_01795) | - | 387597..387815 (+) | 219 | WP_000338528.1 | hypothetical protein | - |
| QQO08_RS01800 (QQO08_01800) | - | 387824..388228 (+) | 405 | WP_000401969.1 | RusA family crossover junction endodeoxyribonuclease | - |
| QQO08_RS01805 (QQO08_01805) | - | 388241..388613 (+) | 373 | Protein_359 | SA1788 family PVL leukocidin-associated protein | - |
| QQO08_RS01810 (QQO08_01810) | - | 388613..388870 (+) | 258 | WP_000111491.1 | DUF3310 domain-containing protein | - |
| QQO08_RS01815 (QQO08_01815) | - | 388873..389115 (+) | 243 | WP_000221871.1 | SAV1978 family virulence-associated passenger protein | - |
| QQO08_RS01820 (QQO08_01820) | - | 389128..389529 (+) | 402 | WP_000695762.1 | hypothetical protein | - |
| QQO08_RS01825 (QQO08_01825) | - | 389526..389873 (+) | 348 | WP_000979209.1 | YopX family protein | - |
| QQO08_RS01830 (QQO08_01830) | - | 389870..390178 (+) | 309 | WP_000144710.1 | hypothetical protein | - |
| QQO08_RS01835 (QQO08_01835) | - | 390171..390419 (+) | 249 | WP_001065026.1 | DUF1024 family protein | - |
| QQO08_RS01840 (QQO08_01840) | - | 390412..390948 (+) | 537 | WP_000185663.1 | dUTPase | - |
| QQO08_RS01845 (QQO08_01845) | - | 390985..391185 (+) | 201 | WP_000195821.1 | DUF1381 domain-containing protein | - |
| QQO08_RS01850 (QQO08_01850) | - | 391284..391520 (+) | 237 | WP_000608279.1 | DUF7366 family protein | - |
| QQO08_RS01855 (QQO08_01855) | rinB | 391513..391686 (+) | 174 | WP_000591891.1 | transcriptional activator RinB | - |
| QQO08_RS01860 (QQO08_01860) | - | 391687..392052 (+) | 366 | WP_000989954.1 | hypothetical protein | - |
| QQO08_RS01865 (QQO08_01865) | - | 392053..392199 (+) | 147 | WP_000989960.1 | hypothetical protein | - |
| QQO08_RS01870 (QQO08_01870) | - | 392223..392663 (+) | 441 | WP_000162703.1 | RinA family phage transcriptional activator | - |
| QQO08_RS01875 (QQO08_01875) | - | 392974..393468 (+) | 495 | WP_000594082.1 | terminase small subunit | - |
| QQO08_RS01880 (QQO08_01880) | - | 393461..394669 (+) | 1209 | WP_001606760.1 | PBSX family phage terminase large subunit | - |
| QQO08_RS01885 (QQO08_01885) | - | 394683..396101 (+) | 1419 | WP_000283553.1 | phage portal protein | - |
| QQO08_RS01890 (QQO08_01890) | - | 396040..397005 (+) | 966 | WP_285238899.1 | phage head morphogenesis protein | - |
| QQO08_RS01895 (QQO08_01895) | - | 397007..397213 (+) | 207 | WP_000346033.1 | hypothetical protein | - |
| QQO08_RS01900 (QQO08_01900) | - | 397318..397914 (+) | 597 | WP_000366932.1 | phage scaffolding protein | - |
| QQO08_RS01905 (QQO08_01905) | - | 397935..398759 (+) | 825 | WP_001135558.1 | N4-gp56 family major capsid protein | - |
| QQO08_RS01910 (QQO08_01910) | - | 398776..399102 (+) | 327 | WP_000278799.1 | Rho termination factor N-terminal domain-containing protein | - |
| QQO08_RS01915 (QQO08_01915) | - | 399102..399416 (+) | 315 | WP_000338935.1 | phage head-tail connector protein | - |
| QQO08_RS01920 (QQO08_01920) | - | 399409..399744 (+) | 336 | WP_017431444.1 | phage head closure protein | - |
| QQO08_RS01925 (QQO08_01925) | - | 399731..400144 (+) | 414 | WP_001151335.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| QQO08_RS01930 (QQO08_01930) | - | 400157..400594 (+) | 438 | WP_044116368.1 | DUF3168 domain-containing protein | - |
| QQO08_RS01935 (QQO08_01935) | - | 400581..401141 (+) | 561 | WP_000046067.1 | hypothetical protein | - |
| QQO08_RS01940 (QQO08_01940) | - | 401203..401697 (+) | 495 | WP_000141082.1 | tail assembly chaperone | - |
| QQO08_RS01945 (QQO08_01945) | - | 401718..402059 (+) | 342 | WP_001580347.1 | hypothetical protein | - |
| QQO08_RS01950 (QQO08_01950) | - | 402062..405031 (+) | 2970 | WP_000414234.1 | phage tail protein | - |
| QQO08_RS01955 (QQO08_01955) | - | 405046..405981 (+) | 936 | WP_000560193.1 | phage tail domain-containing protein | - |
| QQO08_RS01960 (QQO08_01960) | - | 405992..407875 (+) | 1884 | WP_001144702.1 | SGNH/GDSL hydrolase family protein | - |
| QQO08_RS01965 (QQO08_01965) | - | 407888..409786 (+) | 1899 | WP_000323252.1 | hypothetical protein | - |
| QQO08_RS01970 (QQO08_01970) | - | 409786..411609 (+) | 1824 | WP_000259636.1 | phage baseplate upper protein | - |
| QQO08_RS01975 (QQO08_01975) | - | 411609..411986 (+) | 378 | WP_000869363.1 | DUF2977 domain-containing protein | - |
| QQO08_RS01980 (QQO08_01980) | - | 411996..412169 (+) | 174 | WP_015990323.1 | XkdX family protein | - |
| QQO08_RS01985 (QQO08_01985) | - | 412210..412509 (+) | 300 | WP_000466769.1 | DUF2951 domain-containing protein | - |
| QQO08_RS01990 (QQO08_01990) | - | 412646..414520 (+) | 1875 | WP_000524040.1 | glucosaminidase domain-containing protein | - |
| QQO08_RS01995 (QQO08_01995) | - | 414533..415771 (+) | 1239 | WP_000276640.1 | BppU family phage baseplate upper protein | - |
| QQO08_RS02000 (QQO08_02000) | - | 415776..416171 (+) | 396 | WP_000387945.1 | hypothetical protein | - |
| QQO08_RS02005 (QQO08_02005) | - | 416227..416664 (+) | 438 | WP_000354132.1 | phage holin | - |
| QQO08_RS02010 (QQO08_02010) | - | 416645..418090 (+) | 1446 | WP_001148131.1 | SH3 domain-containing protein | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17641.52 Da Isoelectric Point: 5.2672
>NTDB_id=841356 QQO08_RS01785 WP_000934759.1 386197..386667(+) (ssbA) [Staphylococcus aureus strain CC239-MRSA-III(var.) isolate Trinidad&Tobago_2020-048_8421A]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=841356 QQO08_RS01785 WP_000934759.1 386197..386667(+) (ssbA) [Staphylococcus aureus strain CC239-MRSA-III(var.) isolate Trinidad&Tobago_2020-048_8421A]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.932 |
100 |
0.635 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.551 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.203 |
100 |
0.365 |