Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | SA231_RS00095 | Genome accession | NZ_AP024203 |
| Coordinates | 7239..7709 (-) | Length | 156 a.a. |
| NCBI ID | WP_000610648.1 | Uniprot ID | A0A090M1W2 |
| Organism | Staphylococcus aureus strain SA23-1 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 21..28232 | 7239..7709 | within | 0 |
Gene organization within MGE regions
Location: 21..28232
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SA231_RS00010 (SA231_00030) | - | 1226..1435 (-) | 210 | Protein_1 | terminase large subunit | - |
| SA231_RS00015 (SA231_00040) | - | 1432..1776 (-) | 345 | WP_000402904.1 | hypothetical protein | - |
| SA231_RS00020 (SA231_00050) | - | 1907..2206 (-) | 300 | WP_000988336.1 | HNH endonuclease | - |
| SA231_RS00025 (SA231_00060) | - | 2438..2854 (-) | 417 | WP_000590122.1 | hypothetical protein | - |
| SA231_RS00030 (SA231_00070) | - | 2882..3082 (-) | 201 | WP_001622114.1 | DUF1514 family protein | - |
| SA231_RS00035 (SA231_00080) | - | 3082..3231 (-) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| SA231_RS00040 (SA231_00090) | - | 3228..3614 (-) | 387 | WP_000592207.1 | hypothetical protein | - |
| SA231_RS00045 (SA231_00100) | - | 3611..3817 (-) | 207 | WP_000195803.1 | DUF1381 domain-containing protein | - |
| SA231_RS00050 (SA231_00110) | - | 3814..4059 (-) | 246 | WP_001282074.1 | hypothetical protein | - |
| SA231_RS00055 (SA231_00120) | - | 4096..4632 (-) | 537 | WP_001066447.1 | dUTP diphosphatase | - |
| SA231_RS00060 (SA231_00130) | - | 4625..4795 (-) | 171 | WP_000714403.1 | hypothetical protein | - |
| SA231_RS00065 (SA231_00140) | - | 4782..5036 (-) | 255 | WP_001065097.1 | DUF1024 family protein | - |
| SA231_RS00070 (SA231_00150) | - | 5051..5293 (-) | 243 | WP_000131370.1 | SAV1978 family virulence-associated passenger protein | - |
| SA231_RS00075 (SA231_00160) | - | 5297..5665 (-) | 369 | WP_000101288.1 | SA1788 family PVL leukocidin-associated protein | - |
| SA231_RS00080 (SA231_00170) | - | 5678..6082 (-) | 405 | WP_000401960.1 | RusA family crossover junction endodeoxyribonuclease | - |
| SA231_RS00085 (SA231_00180) | - | 6091..6309 (-) | 219 | WP_000338530.1 | hypothetical protein | - |
| SA231_RS00090 (SA231_00190) | - | 6316..7209 (-) | 894 | WP_000148323.1 | DnaD domain-containing protein | - |
| SA231_RS00095 (SA231_00200) | ssbA | 7239..7709 (-) | 471 | WP_000610648.1 | single-stranded DNA-binding protein | Machinery gene |
| SA231_RS00100 (SA231_00210) | - | 7710..8327 (-) | 618 | WP_073394849.1 | MBL fold metallo-hydrolase | - |
| SA231_RS00105 (SA231_00220) | - | 8408..9328 (-) | 921 | WP_000138475.1 | recombinase RecT | - |
| SA231_RS00110 (SA231_00230) | - | 9330..11273 (-) | 1944 | WP_229345004.1 | AAA family ATPase | - |
| SA231_RS00115 (SA231_00240) | - | 11282..11545 (-) | 264 | WP_001205732.1 | hypothetical protein | - |
| SA231_RS00120 (SA231_00250) | - | 11554..11814 (-) | 261 | WP_000291510.1 | DUF1108 family protein | - |
| SA231_RS00125 (SA231_00260) | - | 11819..12121 (-) | 303 | WP_000165371.1 | DUF2482 family protein | - |
| SA231_RS00130 (SA231_00270) | - | 12216..12377 (-) | 162 | WP_000048129.1 | DUF1270 family protein | - |
| SA231_RS00135 (SA231_00280) | - | 12374..12697 (-) | 324 | WP_001120201.1 | DUF771 domain-containing protein | - |
| SA231_RS00140 (SA231_00290) | - | 12752..13132 (+) | 381 | WP_000762519.1 | DUF2513 domain-containing protein | - |
| SA231_RS00145 (SA231_00300) | - | 13119..13316 (-) | 198 | WP_117220114.1 | hypothetical protein | - |
| SA231_RS00150 (SA231_00310) | - | 13332..14084 (-) | 753 | WP_001148605.1 | phage antirepressor KilAC domain-containing protein | - |
| SA231_RS00155 (SA231_00320) | - | 14135..14464 (+) | 330 | WP_000128907.1 | hypothetical protein | - |
| SA231_RS00160 (SA231_00330) | - | 14453..14668 (-) | 216 | WP_001025404.1 | MW1434 family type I TA system toxin | - |
| SA231_RS00165 (SA231_00340) | - | 14665..14946 (-) | 282 | WP_000854074.1 | helix-turn-helix transcriptional regulator | - |
| SA231_RS00170 | - | 14943..15116 (-) | 174 | WP_001801500.1 | hypothetical protein | - |
| SA231_RS00175 (SA231_00350) | - | 15079..15792 (+) | 714 | WP_001031454.1 | XRE family transcriptional regulator | - |
| SA231_RS00180 (SA231_00360) | - | 15808..16740 (+) | 933 | WP_000759682.1 | exonuclease domain-containing protein | - |
| SA231_RS00185 (SA231_00370) | - | 16746..17087 (+) | 342 | WP_000591749.1 | hypothetical protein | - |
| SA231_RS00190 (SA231_00380) | - | 17291..17473 (+) | 183 | WP_000705248.1 | hypothetical protein | - |
| SA231_RS00195 (SA231_00390) | - | 17573..18037 (+) | 465 | WP_000825947.1 | hypothetical protein | - |
| SA231_RS00200 (SA231_00400) | - | 18096..19133 (+) | 1038 | WP_000857191.1 | site-specific integrase | - |
| SA231_RS00205 (SA231_00410) | sph | 19184..20014 (+) | 831 | Protein_40 | sphingomyelin phosphodiesterase | - |
| SA231_RS00210 (SA231_00420) | - | 20271..21290 (-) | 1020 | WP_000595616.1 | leukocidin/hemolysin toxin family protein | - |
| SA231_RS00215 (SA231_00430) | - | 21312..22367 (-) | 1056 | WP_000791399.1 | leukocidin family pore-forming toxin | - |
| SA231_RS00220 (SA231_00440) | - | 22798..24021 (+) | 1224 | WP_000206615.1 | ArgE/DapE family deacylase | - |
| SA231_RS00225 (SA231_00450) | - | 24417..25724 (+) | 1308 | WP_001045070.1 | TrkH family potassium uptake protein | - |
| SA231_RS00230 (SA231_00460) | groL | 26256..27872 (-) | 1617 | WP_000240642.1 | chaperonin GroEL | - |
| SA231_RS00235 (SA231_00470) | groES | 27948..28232 (-) | 285 | WP_000917289.1 | co-chaperone GroES | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17641.52 Da Isoelectric Point: 5.2672
>NTDB_id=84007 SA231_RS00095 WP_000610648.1 7239..7709(-) (ssbA) [Staphylococcus aureus strain SA23-1]
MINRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
MINRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=84007 SA231_RS00095 WP_000610648.1 7239..7709(-) (ssbA) [Staphylococcus aureus strain SA23-1]
ATGATAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGGACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
ATGATAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGGACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.367 |
100 |
0.628 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.176 |
100 |
0.558 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.768 |
100 |
0.372 |