Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   QPR36_RS11555 Genome accession   NZ_CP126577
Coordinates   2430602..2430979 (-) Length   125 a.a.
NCBI ID   WP_014305410.1    Uniprot ID   -
Organism   Bacillus velezensis strain 411     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2425602..2435979
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QPR36_RS11515 (QPR36_11515) - 2426101..2426895 (+) 795 WP_003153106.1 YqhG family protein -
  QPR36_RS11520 (QPR36_11520) sinI 2427072..2427245 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  QPR36_RS11525 (QPR36_11525) sinR 2427279..2427614 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  QPR36_RS11530 (QPR36_11530) tasA 2427662..2428447 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  QPR36_RS11535 (QPR36_11535) sipW 2428511..2429095 (-) 585 WP_012117977.1 signal peptidase I SipW -
  QPR36_RS11540 (QPR36_11540) tapA 2429067..2429738 (-) 672 WP_300949438.1 amyloid fiber anchoring/assembly protein TapA -
  QPR36_RS11545 (QPR36_11545) - 2429997..2430326 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  QPR36_RS11550 (QPR36_11550) - 2430366..2430545 (-) 180 WP_003153093.1 YqzE family protein -
  QPR36_RS11555 (QPR36_11555) comGG 2430602..2430979 (-) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  QPR36_RS11560 (QPR36_11560) comGF 2430980..2431375 (-) 396 WP_003153090.1 competence type IV pilus minor pilin ComGF -
  QPR36_RS11565 (QPR36_11565) comGE 2431389..2431703 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  QPR36_RS11570 (QPR36_11570) comGD 2431687..2432124 (-) 438 WP_043867285.1 competence type IV pilus minor pilin ComGD Machinery gene
  QPR36_RS11575 (QPR36_11575) comGC 2432114..2432422 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  QPR36_RS11580 (QPR36_11580) comGB 2432427..2433464 (-) 1038 WP_024085602.1 competence type IV pilus assembly protein ComGB Machinery gene
  QPR36_RS11585 (QPR36_11585) comGA 2433451..2434521 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  QPR36_RS11590 (QPR36_11590) - 2434720..2435670 (-) 951 WP_014305415.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14170.14 Da        Isoelectric Point: 9.9592

>NTDB_id=838877 QPR36_RS11555 WP_014305410.1 2430602..2430979(-) (comGG) [Bacillus velezensis strain 411]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FRITGSDRRETVQVTIQAETVSGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=838877 QPR36_RS11555 WP_014305410.1 2430602..2430979(-) (comGG) [Bacillus velezensis strain 411]
ATGTACAAATCTGACGGTTTTATCTATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCGAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTACGGAACTGTTTCC
TTCCGCATCACCGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCCGAAACAGTGTCAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512