Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   QPR36_RS11520 Genome accession   NZ_CP126577
Coordinates   2427072..2427245 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain 411     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2422072..2432245
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QPR36_RS11505 (QPR36_11505) gcvT 2422889..2423989 (-) 1101 WP_095315606.1 glycine cleavage system aminomethyltransferase GcvT -
  QPR36_RS11510 (QPR36_11510) - 2424413..2426083 (+) 1671 WP_003153107.1 DEAD/DEAH box helicase -
  QPR36_RS11515 (QPR36_11515) - 2426101..2426895 (+) 795 WP_003153106.1 YqhG family protein -
  QPR36_RS11520 (QPR36_11520) sinI 2427072..2427245 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  QPR36_RS11525 (QPR36_11525) sinR 2427279..2427614 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  QPR36_RS11530 (QPR36_11530) tasA 2427662..2428447 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  QPR36_RS11535 (QPR36_11535) sipW 2428511..2429095 (-) 585 WP_012117977.1 signal peptidase I SipW -
  QPR36_RS11540 (QPR36_11540) tapA 2429067..2429738 (-) 672 WP_300949438.1 amyloid fiber anchoring/assembly protein TapA -
  QPR36_RS11545 (QPR36_11545) - 2429997..2430326 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  QPR36_RS11550 (QPR36_11550) - 2430366..2430545 (-) 180 WP_003153093.1 YqzE family protein -
  QPR36_RS11555 (QPR36_11555) comGG 2430602..2430979 (-) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  QPR36_RS11560 (QPR36_11560) comGF 2430980..2431375 (-) 396 WP_003153090.1 competence type IV pilus minor pilin ComGF -
  QPR36_RS11565 (QPR36_11565) comGE 2431389..2431703 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  QPR36_RS11570 (QPR36_11570) comGD 2431687..2432124 (-) 438 WP_043867285.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=838875 QPR36_RS11520 WP_003153105.1 2427072..2427245(+) (sinI) [Bacillus velezensis strain 411]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=838875 QPR36_RS11520 WP_003153105.1 2427072..2427245(+) (sinI) [Bacillus velezensis strain 411]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702