Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   QN218_RS06270 Genome accession   NZ_CP126534
Coordinates   1197160..1197534 (+) Length   124 a.a.
NCBI ID   WP_060399015.1    Uniprot ID   -
Organism   Bacillus inaquosorum strain BSY82     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1192160..1202534
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QN218_RS06230 - 1192971..1193381 (+) 411 WP_060399022.1 CBS domain-containing protein -
  QN218_RS06235 - 1193359..1193634 (+) 276 WP_060399021.1 hypothetical protein -
  QN218_RS06240 comGA 1193597..1194667 (+) 1071 WP_060399020.1 competence protein ComGA Machinery gene
  QN218_RS06245 comGB 1194654..1195691 (+) 1038 WP_060399019.1 competence type IV pilus assembly protein ComGB Machinery gene
  QN218_RS06250 comGC 1195705..1196001 (+) 297 WP_003236957.1 comG operon protein ComGC Machinery gene
  QN218_RS06255 comGD 1195991..1196422 (+) 432 WP_060399018.1 competence type IV pilus minor pilin ComGD Machinery gene
  QN218_RS06260 comGE 1196406..1196750 (+) 345 WP_060399017.1 competence type IV pilus minor pilin ComGE Machinery gene
  QN218_RS06265 comGF 1196776..1197159 (+) 384 WP_060399016.1 competence type IV pilus minor pilin ComGF Machinery gene
  QN218_RS06270 comGG 1197160..1197534 (+) 375 WP_060399015.1 competence type IV pilus minor pilin ComGG Machinery gene
  QN218_RS06275 - 1197605..1197784 (+) 180 WP_003236949.1 YqzE family protein -
  QN218_RS06280 - 1197826..1198152 (-) 327 WP_029316858.1 YqzG/YhdC family protein -
  QN218_RS06285 tapA 1198425..1199189 (+) 765 WP_060399014.1 amyloid fiber anchoring/assembly protein TapA -
  QN218_RS06290 - 1199173..1199745 (+) 573 WP_080429111.1 signal peptidase I -
  QN218_RS06295 tasA 1199809..1200594 (+) 786 WP_003236939.1 biofilm matrix protein TasA -
  QN218_RS06300 sinR 1200689..1201024 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  QN218_RS06305 sinI 1201058..1201231 (-) 174 WP_003226347.1 anti-repressor SinI family protein Regulator
  QN218_RS06310 - 1201416..1202210 (-) 795 WP_003236936.1 YqhG family protein -

Sequence


Protein


Download         Length: 124 a.a.        Molecular weight: 14278.51 Da        Isoelectric Point: 10.2570

>NTDB_id=838553 QN218_RS06270 WP_060399015.1 1197160..1197534(+) (comGG) [Bacillus inaquosorum strain BSY82]
MYRSKGFIYPAVLFVSALVLLIVNFTAAQYISRCMFEKETKAFYTGENLLQNGALLSIRHVLEQRKGQKGSQQFTYGQVS
YHIHNTSIKEQKQISLKAITESGAERTAQLVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=838553 QN218_RS06270 WP_060399015.1 1197160..1197534(+) (comGG) [Bacillus inaquosorum strain BSY82]
ATGTACCGTTCGAAAGGGTTTATTTATCCCGCTGTTCTTTTTGTCTCCGCGCTTGTGCTGCTGATCGTAAACTTTACTGC
TGCTCAATATATTTCACGCTGCATGTTTGAAAAGGAAACAAAAGCGTTTTACACAGGAGAAAATTTGCTTCAGAATGGCG
CACTTCTTTCAATTCGGCATGTTCTTGAGCAGCGGAAAGGCCAAAAGGGTTCACAGCAGTTTACATATGGGCAGGTTTCT
TATCACATTCACAATACATCGATAAAAGAGCAAAAACAAATCAGCTTAAAAGCCATTACGGAGTCGGGAGCAGAAAGAAC
TGCACAGCTAGTGTTCGATCAAAAACAGAAAAAACTGCTGCGCTGGACAGAATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

82.258

100

0.823