Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   QNM98_RS12400 Genome accession   NZ_CP126226
Coordinates   2530730..2531107 (-) Length   125 a.a.
NCBI ID   WP_015417814.1    Uniprot ID   -
Organism   Bacillus velezensis strain B31     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2525730..2536107
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QNM98_RS12360 (QNM98_12360) - 2526227..2527021 (+) 795 WP_156240427.1 YqhG family protein -
  QNM98_RS12365 (QNM98_12365) sinI 2527198..2527371 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  QNM98_RS12370 (QNM98_12370) sinR 2527405..2527740 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  QNM98_RS12375 (QNM98_12375) - 2527788..2528573 (-) 786 WP_007408329.1 TasA family protein -
  QNM98_RS12380 (QNM98_12380) - 2528638..2529222 (-) 585 WP_015240205.1 signal peptidase I -
  QNM98_RS12385 (QNM98_12385) tapA 2529194..2529865 (-) 672 WP_284064729.1 amyloid fiber anchoring/assembly protein TapA -
  QNM98_RS12390 (QNM98_12390) - 2530124..2530453 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  QNM98_RS12395 (QNM98_12395) - 2530494..2530673 (-) 180 WP_003153093.1 YqzE family protein -
  QNM98_RS12400 (QNM98_12400) comGG 2530730..2531107 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  QNM98_RS12405 (QNM98_12405) comGF 2531108..2531608 (-) 501 WP_256683588.1 competence type IV pilus minor pilin ComGF -
  QNM98_RS12410 (QNM98_12410) comGE 2531517..2531831 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  QNM98_RS12415 (QNM98_12415) comGD 2531815..2532252 (-) 438 WP_043020787.1 competence type IV pilus minor pilin ComGD Machinery gene
  QNM98_RS12420 (QNM98_12420) comGC 2532242..2532550 (-) 309 WP_015417818.1 competence type IV pilus major pilin ComGC Machinery gene
  QNM98_RS12425 (QNM98_12425) comGB 2532555..2533592 (-) 1038 WP_015417819.1 competence type IV pilus assembly protein ComGB Machinery gene
  QNM98_RS12430 (QNM98_12430) comGA 2533579..2534649 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  QNM98_RS12435 (QNM98_12435) - 2534842..2535792 (-) 951 WP_015417820.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 125 a.a.        Molecular weight: 14167.09 Da        Isoelectric Point: 9.7165

>NTDB_id=837185 QNM98_RS12400 WP_015417814.1 2530730..2531107(-) (comGG) [Bacillus velezensis strain B31]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=837185 QNM98_RS12400 WP_015417814.1 2530730..2531107(-) (comGG) [Bacillus velezensis strain B31]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCAGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACAACGACAGGAACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

50.806

99.2

0.504