Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   QNM98_RS12365 Genome accession   NZ_CP126226
Coordinates   2527198..2527371 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain B31     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2522198..2532371
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QNM98_RS12350 (QNM98_12350) gcvT 2523011..2524111 (-) 1101 WP_031378949.1 glycine cleavage system aminomethyltransferase GcvT -
  QNM98_RS12355 (QNM98_12355) - 2524535..2526205 (+) 1671 WP_015417810.1 SNF2-related protein -
  QNM98_RS12360 (QNM98_12360) - 2526227..2527021 (+) 795 WP_156240427.1 YqhG family protein -
  QNM98_RS12365 (QNM98_12365) sinI 2527198..2527371 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  QNM98_RS12370 (QNM98_12370) sinR 2527405..2527740 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  QNM98_RS12375 (QNM98_12375) - 2527788..2528573 (-) 786 WP_007408329.1 TasA family protein -
  QNM98_RS12380 (QNM98_12380) - 2528638..2529222 (-) 585 WP_015240205.1 signal peptidase I -
  QNM98_RS12385 (QNM98_12385) tapA 2529194..2529865 (-) 672 WP_284064729.1 amyloid fiber anchoring/assembly protein TapA -
  QNM98_RS12390 (QNM98_12390) - 2530124..2530453 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  QNM98_RS12395 (QNM98_12395) - 2530494..2530673 (-) 180 WP_003153093.1 YqzE family protein -
  QNM98_RS12400 (QNM98_12400) comGG 2530730..2531107 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  QNM98_RS12405 (QNM98_12405) comGF 2531108..2531608 (-) 501 WP_256683588.1 competence type IV pilus minor pilin ComGF -
  QNM98_RS12410 (QNM98_12410) comGE 2531517..2531831 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  QNM98_RS12415 (QNM98_12415) comGD 2531815..2532252 (-) 438 WP_043020787.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=837183 QNM98_RS12365 WP_003153105.1 2527198..2527371(+) (sinI) [Bacillus velezensis strain B31]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=837183 QNM98_RS12365 WP_003153105.1 2527198..2527371(+) (sinI) [Bacillus velezensis strain B31]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702