Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   QNK07_RS12510 Genome accession   NZ_CP125981
Coordinates   2435764..2435937 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain ZKY06     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2430764..2440937
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QNK07_RS12495 (QNK07_12515) gcvT 2431563..2432651 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  QNK07_RS12500 (QNK07_12520) hepAA 2433093..2434766 (+) 1674 WP_029726726.1 DEAD/DEAH box helicase -
  QNK07_RS12505 (QNK07_12525) yqhG 2434787..2435581 (+) 795 WP_015714249.1 YqhG family protein -
  QNK07_RS12510 (QNK07_12530) sinI 2435764..2435937 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  QNK07_RS12515 (QNK07_12535) sinR 2435971..2436306 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  QNK07_RS12520 (QNK07_12540) tasA 2436399..2437184 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  QNK07_RS12525 (QNK07_12545) sipW 2437248..2437820 (-) 573 WP_072692741.1 signal peptidase I SipW -
  QNK07_RS12530 (QNK07_12550) tapA 2437804..2438565 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  QNK07_RS12535 (QNK07_12555) yqzG 2438837..2439163 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  QNK07_RS12540 (QNK07_12560) spoIITA 2439205..2439384 (-) 180 WP_029726723.1 YqzE family protein -
  QNK07_RS12545 (QNK07_12565) comGG 2439456..2439830 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  QNK07_RS12550 (QNK07_12570) comGF 2439831..2440214 (-) 384 WP_032722118.1 ComG operon protein ComGF Machinery gene
  QNK07_RS12555 (QNK07_12575) comGE 2440240..2440587 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=833909 QNK07_RS12510 WP_003230187.1 2435764..2435937(+) (sinI) [Bacillus subtilis strain ZKY06]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=833909 QNK07_RS12510 WP_003230187.1 2435764..2435937(+) (sinI) [Bacillus subtilis strain ZKY06]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1