Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   QNK07_RS12550 Genome accession   NZ_CP125981
Coordinates   2439831..2440214 (-) Length   127 a.a.
NCBI ID   WP_032722118.1    Uniprot ID   -
Organism   Bacillus subtilis strain ZKY06     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2434831..2445214
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QNK07_RS12510 (QNK07_12530) sinI 2435764..2435937 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  QNK07_RS12515 (QNK07_12535) sinR 2435971..2436306 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  QNK07_RS12520 (QNK07_12540) tasA 2436399..2437184 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  QNK07_RS12525 (QNK07_12545) sipW 2437248..2437820 (-) 573 WP_072692741.1 signal peptidase I SipW -
  QNK07_RS12530 (QNK07_12550) tapA 2437804..2438565 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  QNK07_RS12535 (QNK07_12555) yqzG 2438837..2439163 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  QNK07_RS12540 (QNK07_12560) spoIITA 2439205..2439384 (-) 180 WP_029726723.1 YqzE family protein -
  QNK07_RS12545 (QNK07_12565) comGG 2439456..2439830 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  QNK07_RS12550 (QNK07_12570) comGF 2439831..2440214 (-) 384 WP_032722118.1 ComG operon protein ComGF Machinery gene
  QNK07_RS12555 (QNK07_12575) comGE 2440240..2440587 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  QNK07_RS12560 (QNK07_12580) comGD 2440571..2441002 (-) 432 WP_029726720.1 comG operon protein ComGD Machinery gene
  QNK07_RS12565 (QNK07_12585) comGC 2440992..2441288 (-) 297 WP_029726719.1 comG operon protein ComGC Machinery gene
  QNK07_RS12570 (QNK07_12590) comGB 2441302..2442339 (-) 1038 WP_029317912.1 comG operon protein ComGB Machinery gene
  QNK07_RS12575 (QNK07_12595) comGA 2442326..2443396 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  QNK07_RS12580 (QNK07_12600) - 2443609..2443806 (-) 198 WP_014480259.1 CBS domain-containing protein -
  QNK07_RS12585 (QNK07_12605) corA 2443808..2444761 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14375.50 Da        Isoelectric Point: 5.8940

>NTDB_id=833912 QNK07_RS12550 WP_032722118.1 2439831..2440214(-) (comGF) [Bacillus subtilis strain ZKY06]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADFENCVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=833912 QNK07_RS12550 WP_032722118.1 2439831..2440214(-) (comGF) [Bacillus subtilis strain ZKY06]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGT
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATTTTGAAAATTGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

97.638

100

0.976