Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | QM339_RS09830 | Genome accession | NZ_CP125899 |
| Coordinates | 1993843..1994313 (-) | Length | 156 a.a. |
| NCBI ID | WP_000610648.1 | Uniprot ID | A0A090M1W2 |
| Organism | Staphylococcus aureus strain CHAL3 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1967213..2014837 | 1993843..1994313 | within | 0 |
Gene organization within MGE regions
Location: 1967213..2014837
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QM339_RS09665 (QM339_09665) | - | 1967213..1967707 (+) | 495 | WP_000569884.1 | GNAT family N-acetyltransferase | - |
| QM339_RS09670 (QM339_09670) | - | 1967863..1968480 (+) | 618 | WP_000255550.1 | LysE/ArgO family amino acid transporter | - |
| QM339_RS09675 (QM339_09675) | - | 1968553..1969134 (-) | 582 | WP_001140696.1 | histidine phosphatase family protein | - |
| QM339_RS09680 (QM339_09680) | - | 1969358..1969594 (+) | 237 | WP_000377079.1 | hypothetical protein | - |
| QM339_RS09685 (QM339_09685) | - | 1969591..1969794 (-) | 204 | WP_000145160.1 | sterile alpha motif-like domain-containing protein | - |
| QM339_RS09690 (QM339_09690) | - | 1970135..1970395 (+) | 261 | WP_001059690.1 | hypothetical protein | - |
| QM339_RS09695 (QM339_09695) | - | 1970424..1970612 (+) | 189 | WP_000052076.1 | hypothetical protein | - |
| QM339_RS09700 (QM339_09700) | lnsA | 1970800..1971369 (+) | 570 | WP_001106662.1 | lipoprotein N-acylation protein LnsA | - |
| QM339_RS09705 (QM339_09705) | - | 1971457..1971729 (+) | 273 | WP_001004400.1 | hypothetical protein | - |
| QM339_RS09710 (QM339_09710) | - | 1971802..1972020 (+) | 219 | WP_000005884.1 | hypothetical protein | - |
| QM339_RS09715 (QM339_09715) | - | 1972517..1972717 (-) | 201 | WP_001059082.1 | cold-shock protein | - |
| QM339_RS09720 (QM339_09720) | - | 1973074..1973760 (-) | 687 | WP_001622483.1 | thermonuclease family protein | - |
| QM339_RS09725 (QM339_09725) | - | 1974101..1974622 (-) | 522 | WP_000824479.1 | hypothetical protein | - |
| QM339_RS09730 (QM339_09730) | emp | 1974958..1975983 (-) | 1026 | WP_000727726.1 | extracellular matrix protein-binding adhesin Emp | - |
| QM339_RS09735 (QM339_09735) | vwb | 1976334..1977863 (-) | 1530 | WP_000791723.1 | von Willebrand factor binding protein Vwb | - |
| QM339_RS09740 (QM339_09740) | clfA | 1978084..1981059 (-) | 2976 | WP_283502240.1 | MSCRAMM family adhesin clumping factor ClfA | - |
| QM339_RS09745 (QM339_09745) | - | 1981323..1981853 (-) | 531 | WP_001167163.1 | N-acetyltransferase | - |
| QM339_RS09750 (QM339_09750) | - | 1981992..1982513 (-) | 522 | WP_000608189.1 | hypothetical protein | - |
| QM339_RS09755 (QM339_09755) | - | 1982521..1982676 (-) | 156 | WP_072468882.1 | hypothetical protein | - |
| QM339_RS09760 (QM339_09760) | - | 1983112..1983839 (+) | 728 | Protein_1885 | DUF5067 domain-containing protein | - |
| QM339_RS09765 (QM339_09765) | - | 1984124..1984738 (-) | 615 | WP_000999093.1 | stage II sporulation protein M | - |
| QM339_RS09770 (QM339_09770) | sel | 1985579..1986301 (+) | 723 | WP_000746602.1 | staphylococcal enterotoxin type L | - |
| QM339_RS09775 (QM339_09775) | sec2 | 1986468..1987268 (-) | 801 | WP_001043552.1 | staphylococcal enterotoxin type C2 | - |
| QM339_RS09780 (QM339_09780) | - | 1988052..1988607 (+) | 556 | Protein_1889 | DUF4888 domain-containing protein | - |
| QM339_RS09785 (QM339_09785) | - | 1988828..1989496 (-) | 669 | WP_001001286.1 | restriction endonuclease | - |
| QM339_RS09790 (QM339_09790) | - | 1989489..1989854 (-) | 366 | WP_000939618.1 | hypothetical protein | - |
| QM339_RS09800 (QM339_09800) | - | 1991386..1991640 (-) | 255 | WP_001065097.1 | DUF1024 family protein | - |
| QM339_RS09805 (QM339_09805) | - | 1991655..1991897 (-) | 243 | WP_000131370.1 | SAV1978 family virulence-associated passenger protein | - |
| QM339_RS09810 (QM339_09810) | - | 1991901..1992269 (-) | 369 | WP_000101288.1 | SA1788 family PVL leukocidin-associated protein | - |
| QM339_RS09815 (QM339_09815) | - | 1992282..1992686 (-) | 405 | WP_000401960.1 | RusA family crossover junction endodeoxyribonuclease | - |
| QM339_RS09820 (QM339_09820) | - | 1992695..1992913 (-) | 219 | WP_000338530.1 | hypothetical protein | - |
| QM339_RS09825 (QM339_09825) | - | 1992920..1993813 (-) | 894 | WP_283502241.1 | DnaD domain-containing protein | - |
| QM339_RS09830 (QM339_09830) | ssbA | 1993843..1994313 (-) | 471 | WP_000610648.1 | single-stranded DNA-binding protein | Machinery gene |
| QM339_RS09835 (QM339_09835) | - | 1994314..1994931 (-) | 618 | WP_073394849.1 | MBL fold metallo-hydrolase | - |
| QM339_RS09840 (QM339_09840) | - | 1995012..1995932 (-) | 921 | WP_000138475.1 | recombinase RecT | - |
| QM339_RS09845 (QM339_09845) | - | 1995934..1997877 (-) | 1944 | WP_000700555.1 | AAA family ATPase | - |
| QM339_RS09850 (QM339_09850) | - | 1997886..1998149 (-) | 264 | WP_001205732.1 | hypothetical protein | - |
| QM339_RS09855 (QM339_09855) | - | 1998158..1998418 (-) | 261 | WP_000291510.1 | DUF1108 family protein | - |
| QM339_RS09860 (QM339_09860) | - | 1998423..1998725 (-) | 303 | WP_000165371.1 | DUF2482 family protein | - |
| QM339_RS09865 (QM339_09865) | - | 1998820..1998981 (-) | 162 | WP_161386943.1 | DUF1270 family protein | - |
| QM339_RS09870 (QM339_09870) | - | 1998978..1999301 (-) | 324 | WP_001120201.1 | DUF771 domain-containing protein | - |
| QM339_RS09875 (QM339_09875) | - | 1999356..1999736 (+) | 381 | WP_000762519.1 | DUF2513 domain-containing protein | - |
| QM339_RS09880 (QM339_09880) | - | 1999723..1999920 (-) | 198 | WP_001148862.1 | hypothetical protein | - |
| QM339_RS09885 (QM339_09885) | - | 1999936..2000688 (-) | 753 | WP_001148605.1 | phage antirepressor KilAC domain-containing protein | - |
| QM339_RS09890 (QM339_09890) | - | 2000739..2001068 (+) | 330 | WP_000128907.1 | hypothetical protein | - |
| QM339_RS09895 (QM339_09895) | - | 2001057..2001272 (-) | 216 | WP_001025404.1 | MW1434 family type I TA system toxin | - |
| QM339_RS09900 (QM339_09900) | - | 2001306..2001551 (-) | 246 | WP_043859301.1 | helix-turn-helix transcriptional regulator | - |
| QM339_RS09905 (QM339_09905) | - | 2001548..2001721 (-) | 174 | WP_031908048.1 | hypothetical protein | - |
| QM339_RS09910 (QM339_09910) | - | 2001684..2002397 (+) | 714 | WP_283502244.1 | XRE family transcriptional regulator | - |
| QM339_RS09915 (QM339_09915) | - | 2002413..2003345 (+) | 933 | WP_000759682.1 | exonuclease domain-containing protein | - |
| QM339_RS09920 (QM339_09920) | - | 2003351..2003692 (+) | 342 | WP_000591749.1 | hypothetical protein | - |
| QM339_RS09925 (QM339_09925) | - | 2003896..2004078 (+) | 183 | WP_000705248.1 | hypothetical protein | - |
| QM339_RS09930 (QM339_09930) | - | 2004178..2004642 (+) | 465 | WP_000825947.1 | hypothetical protein | - |
| QM339_RS09935 (QM339_09935) | - | 2004701..2005738 (+) | 1038 | WP_000857191.1 | site-specific integrase | - |
| QM339_RS09940 (QM339_09940) | sph | 2005789..2006619 (+) | 831 | Protein_1921 | sphingomyelin phosphodiesterase | - |
| QM339_RS09945 (QM339_09945) | - | 2006876..2007895 (-) | 1020 | WP_000595616.1 | leukocidin/hemolysin toxin family protein | - |
| QM339_RS09950 (QM339_09950) | - | 2007917..2008972 (-) | 1056 | WP_000791399.1 | leukocidin family pore-forming toxin | - |
| QM339_RS09955 (QM339_09955) | - | 2009403..2010626 (+) | 1224 | WP_000206615.1 | ArgE/DapE family deacylase | - |
| QM339_RS09960 (QM339_09960) | - | 2011022..2012329 (+) | 1308 | WP_001045070.1 | TrkH family potassium uptake protein | - |
| QM339_RS09965 (QM339_09965) | groL | 2012861..2014477 (-) | 1617 | WP_000240642.1 | chaperonin GroEL | - |
| QM339_RS09970 (QM339_09970) | groES | 2014553..2014837 (-) | 285 | WP_000917289.1 | co-chaperone GroES | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17641.52 Da Isoelectric Point: 5.2672
>NTDB_id=833530 QM339_RS09830 WP_000610648.1 1993843..1994313(-) (ssbA) [Staphylococcus aureus strain CHAL3]
MINRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
MINRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=833530 QM339_RS09830 WP_000610648.1 1993843..1994313(-) (ssbA) [Staphylococcus aureus strain CHAL3]
ATGATAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGGACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
ATGATAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGGACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.367 |
100 |
0.628 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.176 |
100 |
0.558 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.768 |
100 |
0.372 |