Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | QM316_RS14310 | Genome accession | NZ_CP125862 |
| Coordinates | 2870745..2871215 (+) | Length | 156 a.a. |
| NCBI ID | WP_000934769.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain 18-02202-1 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2843100..2877645 | 2870745..2871215 | within | 0 |
Gene organization within MGE regions
Location: 2843100..2877645
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QM316_RS14130 (QM316_14110) | - | 2843100..2843726 (-) | 627 | Protein_2744 | nitroreductase family protein | - |
| QM316_RS14135 (QM316_14115) | - | 2843923..2845116 (+) | 1194 | WP_115399462.1 | SdrH family protein | - |
| QM316_RS14140 (QM316_14120) | mroQ | 2845141..2845884 (-) | 744 | WP_000197641.1 | CPBP family intramembrane glutamic endopeptidase MroQ | - |
| QM316_RS14145 (QM316_14125) | groES | 2846059..2846343 (+) | 285 | WP_000917289.1 | co-chaperone GroES | - |
| QM316_RS14150 (QM316_14130) | groL | 2846419..2848035 (+) | 1617 | WP_000240648.1 | chaperonin GroEL | - |
| QM316_RS14155 (QM316_14135) | - | 2848579..2848758 (+) | 180 | WP_000201394.1 | hypothetical protein | - |
| QM316_RS14160 (QM316_14140) | - | 2848755..2849381 (+) | 627 | WP_000216892.1 | hypothetical protein | - |
| QM316_RS14165 (QM316_14145) | - | 2849953..2851260 (-) | 1308 | WP_001045081.1 | TrkH family potassium uptake protein | - |
| QM316_RS14170 (QM316_14150) | hemA | 2851891..2853093 (+) | 1203 | WP_031927406.1 | 5-aminolevulinate synthase | - |
| QM316_RS14175 (QM316_14155) | - | 2853096..2853965 (+) | 870 | WP_151367054.1 | DMT family transporter | - |
| QM316_RS14180 (QM316_14160) | - | 2854463..2855686 (-) | 1224 | WP_000206632.1 | ArgE/DapE family deacylase | - |
| QM316_RS14185 (QM316_14165) | lukH | 2856122..2857177 (+) | 1056 | WP_000791409.1 | bi-component leukocidin LukGH subunit H | - |
| QM316_RS14190 (QM316_14170) | lukG | 2857199..2858215 (+) | 1017 | WP_000595397.1 | bi-component leukocidin LukGH subunit G | - |
| QM316_RS14195 (QM316_14175) | sph | 2858728..2859558 (-) | 831 | Protein_2757 | sphingomyelin phosphodiesterase | - |
| QM316_RS14200 (QM316_14180) | - | 2859609..2860646 (-) | 1038 | WP_221922292.1 | site-specific integrase | - |
| QM316_RS14205 (QM316_14185) | - | 2860754..2861368 (+) | 615 | WP_015980400.1 | hypothetical protein | - |
| QM316_RS14210 (QM316_14190) | - | 2861365..2861511 (-) | 147 | WP_001013104.1 | hypothetical protein | - |
| QM316_RS14215 (QM316_14195) | - | 2861547..2861729 (-) | 183 | WP_000705240.1 | hypothetical protein | - |
| QM316_RS14220 (QM316_14200) | - | 2861929..2862114 (-) | 186 | WP_001089804.1 | hypothetical protein | - |
| QM316_RS14225 (QM316_14205) | - | 2862101..2862256 (-) | 156 | WP_001049399.1 | hypothetical protein | - |
| QM316_RS14230 (QM316_14210) | - | 2862268..2862999 (-) | 732 | WP_001566740.1 | XRE family transcriptional regulator | - |
| QM316_RS14235 (QM316_14215) | - | 2863151..2863363 (+) | 213 | WP_000213811.1 | helix-turn-helix transcriptional regulator | - |
| QM316_RS14240 (QM316_14220) | - | 2863411..2863854 (+) | 444 | WP_000435357.1 | hypothetical protein | - |
| QM316_RS14245 (QM316_14225) | - | 2863961..2864173 (-) | 213 | WP_047213263.1 | hypothetical protein | - |
| QM316_RS14250 (QM316_14230) | - | 2864230..2864979 (+) | 750 | WP_047213634.1 | phage antirepressor KilAC domain-containing protein | - |
| QM316_RS14255 (QM316_14235) | - | 2864995..2865189 (+) | 195 | WP_001148853.1 | hypothetical protein | - |
| QM316_RS14260 (QM316_14240) | - | 2865184..2865540 (-) | 357 | WP_000768245.1 | DUF2513 domain-containing protein | - |
| QM316_RS14265 (QM316_14245) | - | 2865590..2865781 (+) | 192 | WP_000389906.1 | hypothetical protein | - |
| QM316_RS14270 (QM316_14250) | - | 2865783..2866010 (-) | 228 | WP_047213632.1 | hypothetical protein | - |
| QM316_RS14275 (QM316_14255) | - | 2866069..2866389 (+) | 321 | WP_001120935.1 | DUF771 domain-containing protein | - |
| QM316_RS14280 (QM316_14260) | - | 2866386..2866547 (+) | 162 | WP_000066020.1 | DUF1270 domain-containing protein | - |
| QM316_RS14285 (QM316_14265) | - | 2866640..2866900 (+) | 261 | WP_000291489.1 | DUF1108 family protein | - |
| QM316_RS14290 (QM316_14270) | - | 2866909..2867172 (+) | 264 | WP_001205732.1 | hypothetical protein | - |
| QM316_RS14295 (QM316_14275) | - | 2867169..2869124 (+) | 1956 | WP_221922293.1 | AAA family ATPase | - |
| QM316_RS14300 (QM316_14280) | - | 2869126..2870046 (+) | 921 | WP_000138475.1 | recombinase RecT | - |
| QM316_RS14305 (QM316_14285) | - | 2870142..2870744 (+) | 603 | WP_076692545.1 | MBL fold metallo-hydrolase | - |
| QM316_RS14310 (QM316_14290) | ssbA | 2870745..2871215 (+) | 471 | WP_000934769.1 | single-stranded DNA-binding protein | Machinery gene |
| QM316_RS14315 (QM316_14295) | - | 2871245..2872123 (+) | 879 | WP_151366967.1 | DnaD domain protein | - |
| QM316_RS14320 (QM316_14300) | - | 2872136..2872354 (+) | 219 | WP_000338528.1 | hypothetical protein | - |
| QM316_RS14325 (QM316_14305) | - | 2872363..2872767 (+) | 405 | WP_001662398.1 | RusA family crossover junction endodeoxyribonuclease | - |
| QM316_RS14330 (QM316_14310) | - | 2872780..2873148 (+) | 369 | WP_047213626.1 | SA1788 family PVL leukocidin-associated protein | - |
| QM316_RS14335 (QM316_14315) | - | 2873152..2873394 (+) | 243 | WP_000131379.1 | phi PVL orf 51-like protein | - |
| QM316_RS14340 (QM316_14320) | - | 2873409..2873810 (+) | 402 | WP_047213624.1 | hypothetical protein | - |
| QM316_RS14345 (QM316_14325) | - | 2873810..2874085 (+) | 276 | WP_047213622.1 | hypothetical protein | - |
| QM316_RS14350 (QM316_14330) | - | 2874078..2874326 (+) | 249 | WP_047213620.1 | DUF1024 family protein | - |
| QM316_RS14355 (QM316_14335) | - | 2874319..2874855 (+) | 537 | WP_000185669.1 | dUTP diphosphatase | - |
| QM316_RS14360 (QM316_14340) | - | 2874892..2875098 (+) | 207 | WP_000195827.1 | DUF1381 domain-containing protein | - |
| QM316_RS14365 (QM316_14345) | - | 2875095..2875295 (+) | 201 | WP_000573772.1 | hypothetical protein | - |
| QM316_RS14370 (QM316_14350) | - | 2875288..2875437 (+) | 150 | WP_000595240.1 | hypothetical protein | - |
| QM316_RS14375 (QM316_14355) | - | 2875437..2875637 (+) | 201 | WP_047213617.1 | DUF1514 family protein | - |
| QM316_RS14380 (QM316_14360) | - | 2875660..2876121 (+) | 462 | WP_000282745.1 | hypothetical protein | - |
| QM316_RS14385 (QM316_14365) | - | 2876236..2876688 (+) | 453 | WP_000406191.1 | nucleoside triphosphate pyrophosphohydrolase family protein | - |
| QM316_RS14390 (QM316_14370) | - | 2876704..2877048 (+) | 345 | WP_000817289.1 | HNH endonuclease | - |
| QM316_RS14395 (QM316_14375) | - | 2877178..2877645 (+) | 468 | WP_000919026.1 | phage terminase small subunit P27 family | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17671.55 Da Isoelectric Point: 5.2672
>NTDB_id=833124 QM316_RS14310 WP_000934769.1 2870745..2871215(+) (ssbA) [Staphylococcus aureus strain 18-02202-1]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=833124 QM316_RS14310 WP_000934769.1 2870745..2871215(+) (ssbA) [Staphylococcus aureus strain 18-02202-1]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.367 |
100 |
0.628 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.551 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.203 |
100 |
0.365 |