Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   QKW62_RS19780 Genome accession   NZ_CP125310
Coordinates   3958810..3959352 (-) Length   180 a.a.
NCBI ID   WP_021314431.1    Uniprot ID   A0AAW9PN67
Organism   Citrobacter freundii strain CF5125     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 3938330..3976732 3958810..3959352 within 0


Gene organization within MGE regions


Location: 3938330..3976732
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QKW62_RS19640 (QKW62_19635) - 3938330..3939040 (+) 711 WP_059514180.1 tyrosine-type recombinase/integrase -
  QKW62_RS19645 (QKW62_19640) - 3939197..3939451 (+) 255 WP_000104338.1 type II toxin-antitoxin system RelB/DinJ family antitoxin -
  QKW62_RS19650 (QKW62_19645) - 3939441..3939731 (+) 291 WP_000143805.1 type II toxin-antitoxin system RelE/ParE family toxin -
  QKW62_RS19655 (QKW62_19650) - 3940187..3940510 (+) 324 WP_094935762.1 hypothetical protein -
  QKW62_RS19660 (QKW62_19655) - 3940507..3941115 (+) 609 WP_094935763.1 DUF2726 domain-containing protein -
  QKW62_RS19665 (QKW62_19660) - 3941337..3941879 (+) 543 WP_094935764.1 hypothetical protein -
  QKW62_RS19670 (QKW62_19665) - 3941876..3942184 (+) 309 WP_071667453.1 hypothetical protein -
  QKW62_RS19675 (QKW62_19670) - 3942282..3942518 (+) 237 WP_224019239.1 hypothetical protein -
  QKW62_RS19680 (QKW62_19675) - 3942530..3943084 (+) 555 WP_059509465.1 phospholipase D family protein -
  QKW62_RS19685 (QKW62_19680) repA 3943237..3943485 (+) 249 WP_058670686.1 replication regulatory protein RepA -
  QKW62_RS28185 - 3943537..3943659 (-) 123 Protein_3851 replication protein RepA -
  QKW62_RS19690 (QKW62_19685) tap 3943730..3943807 (+) 78 WP_011201829.1 RepA leader peptide Tap -
  QKW62_RS19695 (QKW62_19690) repA 3943788..3944663 (+) 876 WP_094935765.1 incFII family plasmid replication initiator RepA -
  QKW62_RS19700 (QKW62_19695) - 3945766..3946488 (+) 723 WP_025760202.1 NYN domain-containing protein -
  QKW62_RS19705 (QKW62_19700) - 3946508..3947107 (+) 600 WP_025760201.1 DUF2913 family protein -
  QKW62_RS19710 (QKW62_19705) - 3947379..3948641 (+) 1263 WP_000608644.1 IS1380-like element ISEcp1 family transposase -
  QKW62_RS19715 (QKW62_19710) - 3948890..3949765 (+) 876 WP_100663667.1 extended-spectrum class A beta-lactamase KLUC-5 -
  QKW62_RS19720 (QKW62_19715) - 3949812..3950105 (-) 294 WP_100663666.1 WbuC family cupin fold metalloprotein -
  QKW62_RS19725 (QKW62_19720) - 3950242..3950487 (+) 246 Protein_3859 transposase -
  QKW62_RS19730 (QKW62_19725) - 3950500..3951651 (-) 1152 WP_001254932.1 IS30-like element IS30 family transposase -
  QKW62_RS19735 (QKW62_19730) - 3951719..3952612 (+) 894 Protein_3861 IS3 family transposase -
  QKW62_RS19740 (QKW62_19735) - 3952628..3952801 (+) 174 Protein_3862 IS481 family transposase -
  QKW62_RS19750 (QKW62_19745) - 3954432..3954806 (-) 375 WP_001568060.1 hypothetical protein -
  QKW62_RS19755 (QKW62_19750) - 3954862..3955188 (-) 327 WP_001568059.1 hypothetical protein -
  QKW62_RS19760 (QKW62_19755) - 3955185..3955913 (-) 729 WP_001568058.1 plasmid SOS inhibition protein A -
  QKW62_RS19765 (QKW62_19760) psiB 3955910..3956341 (-) 432 WP_001568057.1 conjugation system SOS inhibitor PsiB -
  QKW62_RS19770 (QKW62_19765) - 3956386..3958443 (-) 2058 WP_047066591.1 ParB/RepB/Spo0J family partition protein -
  QKW62_RS19775 (QKW62_19770) - 3958513..3958761 (-) 249 WP_001568055.1 DUF905 domain-containing protein -
  QKW62_RS19780 (QKW62_19775) ssb 3958810..3959352 (-) 543 WP_021314431.1 single-stranded DNA-binding protein Machinery gene
  QKW62_RS19785 (QKW62_19780) - 3960181..3960744 (-) 564 WP_004152756.1 methyltransferase -
  QKW62_RS19790 (QKW62_19785) - 3960792..3962147 (-) 1356 WP_013054814.1 DUF3560 domain-containing protein -
  QKW62_RS19795 (QKW62_19790) - 3962199..3962429 (-) 231 WP_001568051.1 hypothetical protein -
  QKW62_RS19800 (QKW62_19795) - 3962521..3962748 (-) 228 WP_001568050.1 hypothetical protein -
  QKW62_RS19805 (QKW62_19800) - 3963428..3963748 (-) 321 WP_001568049.1 hypothetical protein -
  QKW62_RS19810 (QKW62_19805) - 3963783..3964037 (-) 255 WP_049139361.1 DNA polymerase III subunit theta -
  QKW62_RS19815 (QKW62_19810) - 3964222..3964413 (-) 192 WP_001568047.1 hypothetical protein -
  QKW62_RS19820 (QKW62_19815) - 3964456..3964962 (-) 507 WP_055316506.1 antirestriction protein ArdA -
  QKW62_RS19825 (QKW62_19820) - 3965005..3965433 (-) 429 WP_001568045.1 antirestriction protein -
  QKW62_RS19830 (QKW62_19825) - 3966114..3966881 (-) 768 WP_001568044.1 hypothetical protein -
  QKW62_RS19835 (QKW62_19830) - 3966935..3967354 (-) 420 WP_001568043.1 DUF1380 domain-containing protein -
  QKW62_RS19840 (QKW62_19835) - 3967364..3967585 (-) 222 WP_001568042.1 hypothetical protein -
  QKW62_RS19845 (QKW62_19840) - 3967585..3968286 (-) 702 WP_001568041.1 DNA methylase -
  QKW62_RS19850 (QKW62_19845) - 3968358..3968527 (-) 170 Protein_3884 hypothetical protein -
  QKW62_RS19855 (QKW62_19850) - 3968723..3968953 (-) 231 WP_001568040.1 hypothetical protein -
  QKW62_RS19860 (QKW62_19855) - 3969016..3969687 (-) 672 WP_001568039.1 plasmid partitioning/stability family protein -
  QKW62_RS19865 (QKW62_19860) parM 3969690..3970661 (-) 972 WP_001568038.1 plasmid segregation protein ParM domain-containing protein -
  QKW62_RS19870 (QKW62_19865) umuD 3970895..3971326 (+) 432 WP_001568036.1 translesion error-prone DNA polymerase V autoproteolytic subunit -
  QKW62_RS19875 (QKW62_19870) - 3971326..3972597 (+) 1272 WP_004197646.1 Y-family DNA polymerase -
  QKW62_RS19880 (QKW62_19875) - 3973009..3973884 (+) 876 WP_004098982.1 RepB family plasmid replication initiator protein -
  QKW62_RS19885 (QKW62_19880) - 3974541..3975167 (+) 627 WP_004197649.1 ParA family plasmid-partitioning AAA ATPase -
  QKW62_RS19890 (QKW62_19885) - 3975164..3975466 (+) 303 WP_071571079.1 hypothetical protein -
  QKW62_RS19895 (QKW62_19890) - 3975938..3976732 (-) 795 WP_004197635.1 site-specific integrase -

Sequence


Protein


Download         Length: 180 a.a.        Molecular weight: 19513.95 Da        Isoelectric Point: 7.2058

>NTDB_id=831049 QKW62_RS19780 WP_021314431.1 3958810..3959352(-) (ssb) [Citrobacter freundii strain CF5125]
MAARGVNKVILVGHLGQDPEVRYMPNGGAVVNLTLATSETWRDKQTGEMRENTEWHRVVMFGKLAEVAGEYLRKGAQVFI
EGQLRTRNWQDDAGVTRYVTEVLVGQNGTLQMLGGRRESGVPESAAQPQNPATPAQPAQAAAKSPKAKGGKKGRQDAAPS
QQPPQPLPDDFPPMDDEAPF

Nucleotide


Download         Length: 543 bp        

>NTDB_id=831049 QKW62_RS19780 WP_021314431.1 3958810..3959352(-) (ssb) [Citrobacter freundii strain CF5125]
ATGGCAGCACGTGGCGTTAACAAAGTCATTCTGGTTGGACATCTGGGACAGGACCCGGAAGTGCGTTACATGCCCAACGG
GGGCGCAGTGGTCAATCTGACGCTGGCCACGTCTGAAACATGGCGTGACAAGCAGACGGGAGAGATGCGCGAAAACACCG
AGTGGCACCGTGTTGTCATGTTCGGCAAGCTCGCGGAAGTGGCGGGTGAATACCTGCGTAAAGGCGCACAGGTCTTCATC
GAGGGCCAGCTGCGCACCCGCAACTGGCAGGACGATGCCGGAGTCACGCGCTACGTCACCGAGGTGCTGGTCGGGCAGAA
CGGCACCCTGCAGATGCTCGGCGGCCGCCGTGAATCCGGAGTGCCTGAGAGCGCCGCGCAGCCGCAGAATCCTGCCACCC
CGGCACAACCTGCTCAGGCCGCAGCTAAATCCCCGAAAGCGAAGGGCGGTAAGAAAGGCCGTCAGGATGCCGCCCCGTCT
CAGCAACCGCCTCAGCCACTCCCGGATGATTTCCCACCAATGGATGATGAAGCGCCCTTTTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

57.949

100

0.628

  ssb Glaesserella parasuis strain SC1401

46.809

100

0.489

  ssb Neisseria meningitidis MC58

41.808

98.333

0.411

  ssb Neisseria gonorrhoeae MS11

41.808

98.333

0.411