Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   QJV49_RS06405 Genome accession   NZ_CP124538
Coordinates   1269965..1270240 (-) Length   91 a.a.
NCBI ID   WP_225512506.1    Uniprot ID   A0AA49EYK4
Organism   Lactococcus sp. NH2-7C     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1264965..1275240
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QJV49_RS06375 (QJV49_06375) - 1265405..1265782 (-) 378 WP_225512508.1 pyridoxamine 5'-phosphate oxidase family protein -
  QJV49_RS06380 (QJV49_06380) - 1265987..1266853 (+) 867 WP_058204413.1 RluA family pseudouridine synthase -
  QJV49_RS06385 (QJV49_06385) - 1266891..1267700 (-) 810 WP_014570791.1 metal ABC transporter permease -
  QJV49_RS06390 (QJV49_06390) - 1267693..1268430 (-) 738 WP_012898617.1 metal ABC transporter ATP-binding protein -
  QJV49_RS06395 (QJV49_06395) - 1268607..1269449 (-) 843 WP_225512507.1 metal ABC transporter substrate-binding protein -
  QJV49_RS06400 (QJV49_06400) - 1269446..1269883 (-) 438 WP_010906313.1 zinc-dependent MarR family transcriptional regulator -
  QJV49_RS06405 (QJV49_06405) comGG 1269965..1270240 (-) 276 WP_225512506.1 competence protein ComGG Machinery gene
  QJV49_RS06410 (QJV49_06410) comGF 1270288..1270734 (-) 447 WP_370632039.1 competence type IV pilus minor pilin ComGF Machinery gene
  QJV49_RS06415 (QJV49_06415) comGE 1270697..1270993 (-) 297 WP_225512504.1 competence type IV pilus minor pilin ComGE Machinery gene
  QJV49_RS06420 (QJV49_06420) comGD 1270965..1271396 (-) 432 WP_225512503.1 competence type IV pilus minor pilin ComGD Machinery gene
  QJV49_RS06425 (QJV49_06425) comGC 1271356..1271625 (-) 270 WP_281449176.1 competence type IV pilus major pilin ComGC Machinery gene
  QJV49_RS06430 (QJV49_06430) comGB 1271753..1272826 (-) 1074 WP_225512580.1 competence type IV pilus assembly protein ComGB Machinery gene
  QJV49_RS06435 (QJV49_06435) comGA 1272720..1273658 (-) 939 WP_225512501.1 competence type IV pilus ATPase ComGA Machinery gene

Sequence

Protein


Download         Length: 91 a.a.        Molecular weight: 10401.62 Da        Isoelectric Point: 6.7224

>NTDB_id=826330 QJV49_RS06405 WP_225512506.1 1269965..1270240(-) (comGG) [Lactococcus sp. NH2-7C]
MFLQFYLQTQVADARQLRREKEQLTAELMVSVALKTDLKSQGQIHFDSGNLSYNLLTDSSASSKITDHSSDEKTYQFSIH
LKDGTNFQIKN

Nucleotide


Download         Length: 276 bp        

>NTDB_id=826330 QJV49_RS06405 WP_225512506.1 1269965..1270240(-) (comGG) [Lactococcus sp. NH2-7C]
ATGTTTCTTCAGTTTTATTTGCAGACACAAGTAGCTGATGCTCGACAATTAAGACGTGAAAAGGAGCAGCTAACTGCTGA
ATTAATGGTATCAGTAGCTCTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGGAATTTGTCCTACA
ATTTACTGACAGATTCTTCAGCCAGTTCAAAAATTACTGACCATTCAAGTGATGAAAAAACTTATCAATTTAGTATCCAT
CTAAAAGATGGCACAAACTTTCAAATAAAAAATTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Lactococcus lactis subsp. cremoris KW2

62.222

98.901

0.615