Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   M2Y48_RS00720 Genome accession   NZ_AP023344
Coordinates   152197..152301 (+) Length   34 a.a.
NCBI ID   WP_248419940.1    Uniprot ID   -
Organism   Helicobacter pylori strain JSHR3     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 147197..157301
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  M2Y48_RS00695 (JSHR3_01440) - 147237..149459 (+) 2223 WP_248419939.1 ATP-dependent Clp protease ATP-binding subunit -
  M2Y48_RS00700 (JSHR3_01450) panD 149449..149799 (+) 351 WP_154414081.1 aspartate 1-decarboxylase -
  M2Y48_RS00705 (JSHR3_01460) - 149810..150103 (+) 294 WP_000347922.1 YbaB/EbfC family nucleoid-associated protein -
  M2Y48_RS00710 (JSHR3_01470) - 150103..151098 (+) 996 WP_248420193.1 PDZ domain-containing protein -
  M2Y48_RS00715 (JSHR3_01480) comB6 151106..152161 (+) 1056 WP_248420195.1 P-type conjugative transfer protein TrbL Machinery gene
  M2Y48_RS00720 comB7 152197..152301 (+) 105 WP_248419940.1 comB7 lipoprotein Machinery gene
  M2Y48_RS00725 (JSHR3_01490) comB8 152298..153041 (+) 744 WP_000660524.1 virB8 family protein Machinery gene
  M2Y48_RS00730 (JSHR3_01500) comB9 153041..154006 (+) 966 WP_231216038.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  M2Y48_RS00735 (JSHR3_01510) comB10 153999..155135 (+) 1137 WP_001045734.1 DNA type IV secretion system protein ComB10 Machinery gene
  M2Y48_RS00740 (JSHR3_01530) - 155205..156618 (+) 1414 Protein_144 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 34 a.a.        Molecular weight: 3925.66 Da        Isoelectric Point: 8.5447

>NTDB_id=82442 M2Y48_RS00720 WP_248419940.1 152197..152301(+) (comB7) [Helicobacter pylori strain JSHR3]
MGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNFA

Nucleotide


Download         Length: 105 bp        

>NTDB_id=82442 M2Y48_RS00720 WP_248419940.1 152197..152301(+) (comB7) [Helicobacter pylori strain JSHR3]
ATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTGCACATTGCATGAAAAGTTATA
TGAAAACAGGTTGAATTTTGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

82.353

100

0.824


Multiple sequence alignment