Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   QE150_RS15185 Genome accession   NZ_CP123993
Coordinates   3053757..3054110 (-) Length   117 a.a.
NCBI ID   WP_004738307.1    Uniprot ID   -
Organism   Acinetobacter baumannii strain Ab4294     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 3047961..3090654 3053757..3054110 within 0


Gene organization within MGE regions


Location: 3047961..3090654
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QE150_RS15155 (QE150_15160) - 3047961..3048908 (+) 948 WP_206217264.1 LysR substrate-binding domain-containing protein -
  QE150_RS15160 (QE150_15165) - 3048998..3050173 (-) 1176 WP_270901908.1 zinc-binding dehydrogenase -
  QE150_RS15165 (QE150_15170) add 3050576..3051571 (+) 996 WP_000629031.1 adenosine deaminase -
  QE150_RS15175 (QE150_15180) - 3052284..3053444 (-) 1161 WP_004738311.1 tyrosine-type recombinase/integrase -
  QE150_RS15180 (QE150_15185) - 3053533..3053736 (-) 204 WP_004738309.1 hypothetical protein -
  QE150_RS15185 (QE150_15190) ssb 3053757..3054110 (-) 354 WP_004738307.1 single-stranded DNA-binding protein Machinery gene
  QE150_RS15190 (QE150_15195) - 3054098..3054415 (-) 318 WP_004738305.1 hypothetical protein -
  QE150_RS15195 (QE150_15200) - 3054408..3054761 (-) 354 WP_004738303.1 hypothetical protein -
  QE150_RS15200 (QE150_15205) - 3054765..3055283 (-) 519 WP_004738302.1 hypothetical protein -
  QE150_RS15205 (QE150_15210) - 3055351..3055953 (-) 603 WP_004738299.1 hypothetical protein -
  QE150_RS15210 (QE150_15215) - 3055970..3058696 (-) 2727 WP_004738296.1 toprim domain-containing protein -
  QE150_RS15215 (QE150_15220) - 3058706..3058876 (-) 171 WP_004738295.1 hypothetical protein -
  QE150_RS15220 (QE150_15225) - 3058891..3059130 (-) 240 WP_004738293.1 hypothetical protein -
  QE150_RS15225 (QE150_15230) - 3059133..3059333 (-) 201 WP_004738291.1 hypothetical protein -
  QE150_RS15230 (QE150_15235) - 3059417..3059767 (+) 351 WP_004738288.1 hypothetical protein -
  QE150_RS15235 (QE150_15240) - 3059764..3060342 (-) 579 WP_004738286.1 hypothetical protein -
  QE150_RS15240 (QE150_15245) - 3060339..3060662 (-) 324 WP_281309348.1 hypothetical protein -
  QE150_RS15245 (QE150_15250) - 3061078..3062085 (+) 1008 WP_004738282.1 WYL domain-containing protein -
  QE150_RS15250 (QE150_15255) - 3062117..3062926 (+) 810 WP_004738281.1 trypsin-like peptidase domain-containing protein -
  QE150_RS15255 (QE150_15260) - 3063259..3064491 (-) 1233 WP_004738280.1 acyltransferase -
  QE150_RS15260 (QE150_15265) - 3064566..3064841 (-) 276 WP_270898599.1 hypothetical protein -
  QE150_RS15265 (QE150_15270) - 3064846..3065241 (-) 396 WP_004738278.1 hypothetical protein -
  QE150_RS15270 (QE150_15275) - 3065241..3065528 (-) 288 WP_004738277.1 ogr/Delta-like zinc finger family protein -
  QE150_RS15275 (QE150_15280) - 3065807..3066598 (+) 792 WP_004738276.1 DNA adenine methylase -
  QE150_RS15280 (QE150_15285) - 3066595..3067812 (-) 1218 WP_004738275.1 contractile injection system protein, VgrG/Pvc8 family -
  QE150_RS15285 (QE150_15290) - 3067816..3068235 (-) 420 WP_004738274.1 phage tail protein -
  QE150_RS15290 (QE150_15295) - 3068250..3071879 (-) 3630 WP_004738273.1 hypothetical protein -
  QE150_RS15295 (QE150_15300) - 3071876..3071944 (-) 69 WP_238826551.1 GpE family phage tail protein -
  QE150_RS15300 (QE150_15305) - 3072004..3072384 (-) 381 WP_004738270.1 phage tail assembly protein -
  QE150_RS15305 (QE150_15310) - 3072446..3072961 (-) 516 WP_004738268.1 phage major tail tube protein -
  QE150_RS15310 (QE150_15315) - 3072973..3074142 (-) 1170 WP_004738266.1 phage tail sheath protein -
  QE150_RS15315 (QE150_15320) - 3074251..3074748 (-) 498 WP_281309349.1 hypothetical protein -
  QE150_RS15320 (QE150_15325) - 3074750..3078373 (-) 3624 WP_005111999.1 phage tail protein -
  QE150_RS15325 (QE150_15330) - 3078374..3078910 (-) 537 WP_005112001.1 phage tail protein I -
  QE150_RS15330 (QE150_15335) - 3078910..3079803 (-) 894 WP_254231394.1 baseplate J/gp47 family protein -
  QE150_RS15335 (QE150_15340) - 3079824..3080174 (-) 351 WP_005112006.1 GPW/gp25 family protein -
  QE150_RS15340 (QE150_15345) - 3080171..3080725 (-) 555 WP_005112007.1 phage baseplate assembly protein V -
  QE150_RS15345 (QE150_15350) - 3080786..3081247 (-) 462 WP_005112009.1 phage virion morphogenesis protein -
  QE150_RS15350 (QE150_15355) - 3081251..3081781 (-) 531 WP_005112011.1 phage tail protein -
  QE150_RS15355 (QE150_15360) - 3081778..3082608 (-) 831 WP_005112012.1 N-acetylmuramidase family protein -
  QE150_RS15360 (QE150_15365) - 3082605..3082862 (-) 258 WP_004738245.1 phage holin family protein -
  QE150_RS15365 (QE150_15370) - 3082859..3083218 (-) 360 WP_005112015.1 putative holin -
  QE150_RS15370 (QE150_15375) - 3083221..3083430 (-) 210 WP_005112016.1 tail protein X -
  QE150_RS15375 (QE150_15380) - 3083427..3083876 (-) 450 WP_004703731.1 head completion/stabilization protein -
  QE150_RS15380 (QE150_15385) gpM 3083977..3084741 (-) 765 WP_005112018.1 phage terminase small subunit -
  QE150_RS15385 (QE150_15390) - 3084748..3085758 (-) 1011 WP_004703735.1 phage major capsid protein, P2 family -
  QE150_RS15390 (QE150_15395) - 3085791..3086642 (-) 852 WP_005112021.1 GPO family capsid scaffolding protein -
  QE150_RS15395 (QE150_15400) - 3086821..3088599 (+) 1779 WP_005112022.1 terminase family protein -
  QE150_RS15400 (QE150_15405) - 3088596..3089642 (+) 1047 WP_194299481.1 phage portal protein -
  QE150_RS15405 (QE150_15410) - 3089653..3089868 (+) 216 WP_227552920.1 hypothetical protein -
  QE150_RS15410 (QE150_15415) - 3089976..3090155 (+) 180 WP_000009390.1 type II toxin-antitoxin system HicA family toxin -
  QE150_RS15415 (QE150_15420) - 3090241..3090654 (+) 414 WP_005112025.1 hypothetical protein -

Sequence

Protein


Download         Length: 117 a.a.        Molecular weight: 13204.83 Da        Isoelectric Point: 9.8037

>NTDB_id=823666 QE150_RS15185 WP_004738307.1 3053757..3054110(-) (ssb) [Acinetobacter baumannii strain Ab4294]
MRGINKVILVGSLGANPITKHYPNGNTYVQFSIATSEKYQDKNTGEWIENTEWHRIIAYGRLGEVATQILKKGSKVYVEG
SLRTRQVTDQRGQQGYITEVRANTFQSLDSLPQANPY

Nucleotide


Download         Length: 354 bp        

>NTDB_id=823666 QE150_RS15185 WP_004738307.1 3053757..3054110(-) (ssb) [Acinetobacter baumannii strain Ab4294]
ATGCGCGGGATAAATAAAGTCATTCTTGTGGGAAGTTTAGGTGCAAATCCAATAACCAAACATTACCCGAACGGTAATAC
TTACGTTCAGTTTTCGATTGCTACTTCAGAAAAGTATCAAGATAAAAACACAGGTGAATGGATTGAGAATACGGAATGGC
ATCGAATTATTGCATACGGTCGATTAGGTGAGGTTGCCACTCAAATCTTAAAAAAAGGTTCAAAAGTTTATGTAGAGGGT
TCTTTACGAACAAGACAAGTTACCGACCAAAGAGGTCAGCAAGGTTATATAACCGAAGTAAGGGCAAACACCTTTCAGTC
TTTAGATAGCCTTCCGCAAGCAAACCCTTATTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(4-107)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Glaesserella parasuis strain SC1401

54.545

94.017

0.513
  ssb Vibrio cholerae strain A1552

54.545

84.615

0.462
  ssb Neisseria gonorrhoeae MS11

42.857

89.744

0.385
  ssb Neisseria meningitidis MC58

42.857

89.744

0.385