Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   QEP20_RS12390 Genome accession   NZ_CP123977
Coordinates   2412739..2413113 (-) Length   124 a.a.
NCBI ID   WP_029726722.1    Uniprot ID   -
Organism   Bacillus subtilis subsp. subtilis strain WH60A     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2407739..2418113
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QEP20_RS12350 (QEP20_12350) yqhG 2408071..2408865 (+) 795 WP_015714249.1 YqhG family protein -
  QEP20_RS12355 (QEP20_12355) sinI 2409048..2409221 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  QEP20_RS12360 (QEP20_12360) sinR 2409255..2409590 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  QEP20_RS12365 (QEP20_12365) tasA 2409683..2410468 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  QEP20_RS12370 (QEP20_12370) sipW 2410532..2411104 (-) 573 WP_072692741.1 signal peptidase I -
  QEP20_RS12375 (QEP20_12375) tapA 2411088..2411849 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  QEP20_RS12380 (QEP20_12380) yqzG 2412120..2412446 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  QEP20_RS12385 (QEP20_12385) spoIIT 2412488..2412667 (-) 180 WP_029726723.1 YqzE family protein -
  QEP20_RS12390 (QEP20_12390) comGG 2412739..2413113 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  QEP20_RS12395 (QEP20_12395) comGF 2413114..2413497 (-) 384 WP_029726721.1 ComG operon protein ComGF Machinery gene
  QEP20_RS12400 (QEP20_12400) comGE 2413523..2413870 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  QEP20_RS12405 (QEP20_12405) comGD 2413854..2414285 (-) 432 WP_029726720.1 comG operon protein ComGD Machinery gene
  QEP20_RS12410 (QEP20_12410) comGC 2414275..2414571 (-) 297 WP_029726719.1 comG operon protein ComGC Machinery gene
  QEP20_RS12415 (QEP20_12415) comGB 2414585..2415622 (-) 1038 WP_029726718.1 comG operon protein ComGB Machinery gene
  QEP20_RS12420 (QEP20_12420) comGA 2415609..2416679 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  QEP20_RS12425 (QEP20_12425) - 2416892..2417089 (-) 198 WP_029726717.1 hypothetical protein -
  QEP20_RS12430 (QEP20_12430) corA 2417091..2418044 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 124 a.a.        Molecular weight: 14443.63 Da        Isoelectric Point: 7.8383

>NTDB_id=823480 QEP20_RS12390 WP_029726722.1 2412739..2413113(-) (comGG) [Bacillus subtilis subsp. subtilis strain WH60A]
MYCTRGFIYPAVLFVSALVLLIVNFAAAQYISRCMFEKETKELYIGENLLQNGVLLSVRHVLEERKGQEGTEQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=823480 QEP20_RS12390 WP_029726722.1 2412739..2413113(-) (comGG) [Bacillus subtilis subsp. subtilis strain WH60A]
ATGTATTGTACAAGAGGGTTTATTTACCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGCTGC
TGCTCAATATATTTCACGCTGCATGTTTGAGAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGGTCCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGTACGGAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTGTTTGATCAAAAACAGAAAAAACTGCTGAGATGGACAGAATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

95.161

100

0.952