Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   QEP20_RS12355 Genome accession   NZ_CP123977
Coordinates   2409048..2409221 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis subsp. subtilis strain WH60A     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2404048..2414221
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QEP20_RS12340 (QEP20_12340) gcvT 2404848..2405936 (-) 1089 WP_015714248.1 glycine cleavage system aminomethyltransferase GcvT -
  QEP20_RS12345 (QEP20_12345) yqhH 2406377..2408050 (+) 1674 WP_029726726.1 SNF2-related protein -
  QEP20_RS12350 (QEP20_12350) yqhG 2408071..2408865 (+) 795 WP_015714249.1 YqhG family protein -
  QEP20_RS12355 (QEP20_12355) sinI 2409048..2409221 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  QEP20_RS12360 (QEP20_12360) sinR 2409255..2409590 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  QEP20_RS12365 (QEP20_12365) tasA 2409683..2410468 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  QEP20_RS12370 (QEP20_12370) sipW 2410532..2411104 (-) 573 WP_072692741.1 signal peptidase I -
  QEP20_RS12375 (QEP20_12375) tapA 2411088..2411849 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  QEP20_RS12380 (QEP20_12380) yqzG 2412120..2412446 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  QEP20_RS12385 (QEP20_12385) spoIIT 2412488..2412667 (-) 180 WP_029726723.1 YqzE family protein -
  QEP20_RS12390 (QEP20_12390) comGG 2412739..2413113 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  QEP20_RS12395 (QEP20_12395) comGF 2413114..2413497 (-) 384 WP_029726721.1 ComG operon protein ComGF Machinery gene
  QEP20_RS12400 (QEP20_12400) comGE 2413523..2413870 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=823478 QEP20_RS12355 WP_003230187.1 2409048..2409221(+) (sinI) [Bacillus subtilis subsp. subtilis strain WH60A]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=823478 QEP20_RS12355 WP_003230187.1 2409048..2409221(+) (sinI) [Bacillus subtilis subsp. subtilis strain WH60A]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1