Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | NUG19_RS13670 | Genome accession | NZ_CP123853 |
| Coordinates | 2764300..2764770 (+) | Length | 156 a.a. |
| NCBI ID | WP_000934769.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain FDA209P | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2741165..2772452 | 2764300..2764770 | within | 0 |
Gene organization within MGE regions
Location: 2741165..2772452
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUG19_RS13520 | groES | 2741165..2741449 (+) | 285 | WP_000917289.1 | co-chaperone GroES | - |
| NUG19_RS13525 | groL | 2741525..2743141 (+) | 1617 | WP_000240645.1 | chaperonin GroEL | - |
| NUG19_RS13530 | - | 2743675..2743854 (+) | 180 | WP_000201397.1 | hypothetical protein | - |
| NUG19_RS13535 | - | 2743851..2744477 (+) | 627 | WP_000216894.1 | hypothetical protein | - |
| NUG19_RS13540 | - | 2745049..2746356 (-) | 1308 | WP_001045078.1 | TrkH family potassium uptake protein | - |
| NUG19_RS13545 | - | 2746517..2747428 (+) | 912 | WP_000825510.1 | iron-hydroxamate ABC transporter substrate-binding protein | - |
| NUG19_RS13550 | - | 2747490..2748335 (+) | 846 | WP_000812008.1 | class I SAM-dependent methyltransferase | - |
| NUG19_RS13555 | - | 2748707..2749930 (-) | 1224 | WP_000206641.1 | ArgE/DapE family deacylase | - |
| NUG19_RS13560 | lukH | 2750365..2751417 (+) | 1053 | WP_000791404.1 | bi-component leukocidin LukGH subunit H | - |
| NUG19_RS13565 | lukG | 2751439..2752455 (+) | 1017 | WP_000595401.1 | bi-component leukocidin LukGH subunit G | - |
| NUG19_RS13570 | sph | 2752693..2753523 (-) | 831 | Protein_2631 | sphingomyelin phosphodiesterase | - |
| NUG19_RS13575 | - | 2753574..2754611 (-) | 1038 | WP_000857176.1 | site-specific integrase | - |
| NUG19_RS13580 | - | 2754719..2755333 (+) | 615 | WP_000191459.1 | hypothetical protein | - |
| NUG19_RS13585 | - | 2755330..2755476 (-) | 147 | WP_001013104.1 | hypothetical protein | - |
| NUG19_RS13590 | - | 2755512..2755694 (-) | 183 | WP_000705243.1 | hypothetical protein | - |
| NUG19_RS13595 | - | 2755739..2756596 (-) | 858 | WP_000804508.1 | HIRAN domain-containing protein | - |
| NUG19_RS13600 | - | 2756608..2757324 (-) | 717 | WP_001083967.1 | LexA family transcriptional regulator | - |
| NUG19_RS13605 | - | 2757488..2757730 (+) | 243 | WP_000639922.1 | DUF739 family protein | - |
| NUG19_RS13610 | - | 2757746..2758534 (+) | 789 | WP_001148565.1 | phage antirepressor KilAC domain-containing protein | - |
| NUG19_RS13615 | - | 2758550..2758744 (+) | 195 | WP_001148859.1 | hypothetical protein | - |
| NUG19_RS13620 | - | 2758739..2759095 (-) | 357 | WP_000768245.1 | DUF2513 domain-containing protein | - |
| NUG19_RS13625 | - | 2759145..2759336 (+) | 192 | WP_000389906.1 | hypothetical protein | - |
| NUG19_RS13630 | - | 2759338..2759565 (-) | 228 | WP_000801108.1 | hypothetical protein | - |
| NUG19_RS13635 | - | 2759624..2759944 (+) | 321 | WP_001798161.1 | DUF771 domain-containing protein | - |
| NUG19_RS13640 | - | 2759941..2760102 (+) | 162 | WP_000066020.1 | DUF1270 domain-containing protein | - |
| NUG19_RS13645 | - | 2760195..2760455 (+) | 261 | WP_000291488.1 | DUF1108 family protein | - |
| NUG19_RS13650 | - | 2760464..2760727 (+) | 264 | WP_042727568.1 | hypothetical protein | - |
| NUG19_RS13655 | - | 2760724..2762679 (+) | 1956 | WP_001813910.1 | AAA family ATPase | - |
| NUG19_RS13660 | - | 2762681..2763601 (+) | 921 | WP_000138475.1 | recombinase RecT | - |
| NUG19_RS13665 | - | 2763682..2764299 (+) | 618 | WP_071621397.1 | MBL fold metallo-hydrolase | - |
| NUG19_RS13670 | ssbA | 2764300..2764770 (+) | 471 | WP_000934769.1 | single-stranded DNA-binding protein | Machinery gene |
| NUG19_RS13675 | - | 2764800..2765693 (+) | 894 | WP_000148329.1 | DnaD domain-containing protein | - |
| NUG19_RS13680 | - | 2765700..2765918 (+) | 219 | WP_000338528.1 | hypothetical protein | - |
| NUG19_RS13685 | - | 2765927..2766331 (+) | 405 | WP_000401964.1 | RusA family crossover junction endodeoxyribonuclease | - |
| NUG19_RS13690 | - | 2766344..2766712 (+) | 369 | WP_000101270.1 | SA1788 family PVL leukocidin-associated protein | - |
| NUG19_RS13695 | - | 2766716..2766958 (+) | 243 | WP_000131377.1 | phi PVL orf 51-like protein | - |
| NUG19_RS13700 | - | 2766972..2767358 (+) | 387 | WP_000693615.1 | hypothetical protein | - |
| NUG19_RS13705 | - | 2767355..2767549 (+) | 195 | WP_000983954.1 | hypothetical protein | - |
| NUG19_RS13710 | - | 2767546..2767995 (+) | 450 | WP_000982708.1 | YopX family protein | - |
| NUG19_RS13715 | - | 2767992..2768276 (+) | 285 | WP_001105621.1 | hypothetical protein | - |
| NUG19_RS13720 | - | 2768269..2768517 (+) | 249 | WP_001065083.1 | DUF1024 family protein | - |
| NUG19_RS13725 | - | 2768510..2769046 (+) | 537 | WP_000185669.1 | dUTP diphosphatase | - |
| NUG19_RS13730 | - | 2769083..2769289 (+) | 207 | WP_000195810.1 | DUF1381 domain-containing protein | - |
| NUG19_RS13735 | - | 2769286..2769435 (+) | 150 | WP_000595267.1 | hypothetical protein | - |
| NUG19_RS13740 | - | 2769594..2770244 (+) | 651 | WP_001005262.1 | hypothetical protein | - |
| NUG19_RS13745 | - | 2770244..2770444 (+) | 201 | WP_000265041.1 | DUF1514 family protein | - |
| NUG19_RS13750 | - | 2770467..2770928 (+) | 462 | WP_000282753.1 | hypothetical protein | - |
| NUG19_RS13755 | - | 2771043..2771495 (+) | 453 | WP_000406187.1 | nucleoside triphosphate pyrophosphohydrolase family protein | - |
| NUG19_RS13760 | - | 2771511..2771855 (+) | 345 | WP_000817289.1 | HNH endonuclease | - |
| NUG19_RS13765 | - | 2771985..2772452 (+) | 468 | WP_000919026.1 | phage terminase small subunit P27 family | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17671.55 Da Isoelectric Point: 5.2672
>NTDB_id=822819 NUG19_RS13670 WP_000934769.1 2764300..2764770(+) (ssbA) [Staphylococcus aureus strain FDA209P]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=822819 NUG19_RS13670 WP_000934769.1 2764300..2764770(+) (ssbA) [Staphylococcus aureus strain FDA209P]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.367 |
100 |
0.628 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.551 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.203 |
100 |
0.365 |