Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | QFH15_RS08155 | Genome accession | NZ_CP123618 |
| Coordinates | 1657032..1657532 (+) | Length | 166 a.a. |
| NCBI ID | WP_005725039.1 | Uniprot ID | A0A379BD60 |
| Organism | Pasteurella multocida strain 19BRD-057 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1657032..1707659 | 1657032..1657532 | within | 0 |
Gene organization within MGE regions
Location: 1657032..1707659
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QFH15_RS08155 (QFH15_08155) | ssb | 1657032..1657532 (+) | 501 | WP_005725039.1 | single-stranded DNA-binding protein | Machinery gene |
| QFH15_RS08160 (QFH15_08160) | - | 1657618..1658025 (-) | 408 | WP_170345843.1 | hypothetical protein | - |
| QFH15_RS08165 (QFH15_08165) | folD | 1658041..1658895 (-) | 855 | WP_156732384.1 | bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD | - |
| QFH15_RS08180 (QFH15_08180) | - | 1659270..1660325 (-) | 1056 | WP_223131900.1 | site-specific integrase | - |
| QFH15_RS08185 (QFH15_08185) | - | 1660229..1660531 (-) | 303 | WP_075271365.1 | helix-turn-helix domain-containing protein | - |
| QFH15_RS08190 (QFH15_08190) | - | 1660760..1660948 (-) | 189 | WP_169326194.1 | hypothetical protein | - |
| QFH15_RS08195 (QFH15_08195) | - | 1661084..1661395 (-) | 312 | WP_262495049.1 | hypothetical protein | - |
| QFH15_RS08200 (QFH15_08200) | - | 1661451..1661981 (-) | 531 | WP_223131901.1 | DUF551 domain-containing protein | - |
| QFH15_RS08205 (QFH15_08205) | - | 1662021..1662332 (-) | 312 | WP_223131902.1 | hypothetical protein | - |
| QFH15_RS08210 (QFH15_08210) | - | 1662334..1662516 (-) | 183 | WP_211634800.1 | hypothetical protein | - |
| QFH15_RS08215 (QFH15_08215) | ssb | 1662557..1663012 (-) | 456 | WP_223131903.1 | single-stranded DNA-binding protein | Machinery gene |
| QFH15_RS08220 (QFH15_08220) | - | 1663016..1663627 (-) | 612 | WP_064775601.1 | YqaJ viral recombinase family protein | - |
| QFH15_RS08225 (QFH15_08225) | bet | 1663620..1664471 (-) | 852 | WP_016533454.1 | phage recombination protein Bet | - |
| QFH15_RS08230 (QFH15_08230) | - | 1664475..1665467 (-) | 993 | WP_223131904.1 | hypothetical protein | - |
| QFH15_RS08235 (QFH15_08235) | - | 1665470..1665631 (-) | 162 | WP_014390707.1 | hypothetical protein | - |
| QFH15_RS08240 (QFH15_08240) | - | 1665645..1665881 (-) | 237 | WP_016570068.1 | hypothetical protein | - |
| QFH15_RS08245 (QFH15_08245) | - | 1665868..1666152 (-) | 285 | WP_016570069.1 | hypothetical protein | - |
| QFH15_RS08250 (QFH15_08250) | - | 1666300..1666530 (+) | 231 | WP_223251317.1 | hypothetical protein | - |
| QFH15_RS08255 (QFH15_08255) | - | 1666592..1667227 (-) | 636 | WP_016569990.1 | Bro-N domain-containing protein | - |
| QFH15_RS08260 (QFH15_08260) | - | 1667604..1668014 (+) | 411 | WP_115173413.1 | hypothetical protein | - |
| QFH15_RS08270 (QFH15_08270) | - | 1668625..1668798 (+) | 174 | WP_167409471.1 | hypothetical protein | - |
| QFH15_RS08275 (QFH15_08275) | - | 1668785..1669024 (-) | 240 | WP_223131905.1 | hypothetical protein | - |
| QFH15_RS08280 (QFH15_08280) | - | 1669050..1669277 (-) | 228 | WP_223131906.1 | hypothetical protein | - |
| QFH15_RS08285 (QFH15_08285) | - | 1669738..1670052 (+) | 315 | WP_223131907.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| QFH15_RS08290 (QFH15_08290) | - | 1670049..1670339 (+) | 291 | WP_223131908.1 | addiction module antidote protein | - |
| QFH15_RS08295 (QFH15_08295) | - | 1670382..1671014 (-) | 633 | WP_223131909.1 | S24 family peptidase | - |
| QFH15_RS08300 (QFH15_08300) | - | 1671152..1671358 (+) | 207 | WP_064965013.1 | helix-turn-helix transcriptional regulator | - |
| QFH15_RS08305 (QFH15_08305) | - | 1671407..1671856 (+) | 450 | WP_223131910.1 | YmfL family putative regulatory protein | - |
| QFH15_RS08310 (QFH15_08310) | - | 1671914..1672597 (+) | 684 | WP_223131911.1 | phage antirepressor KilAC domain-containing protein | - |
| QFH15_RS12930 | - | 1672682..1673113 (+) | 432 | Protein_1606 | DNA replication protein | - |
| QFH15_RS08320 (QFH15_08320) | - | 1673791..1675227 (+) | 1437 | WP_223131912.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| QFH15_RS08325 (QFH15_08325) | - | 1675231..1675656 (+) | 426 | WP_223131940.1 | recombination protein NinB | - |
| QFH15_RS08330 (QFH15_08330) | - | 1676178..1676333 (+) | 156 | WP_155736201.1 | hypothetical protein | - |
| QFH15_RS08335 (QFH15_08335) | - | 1676633..1676839 (+) | 207 | WP_064965023.1 | hypothetical protein | - |
| QFH15_RS08340 (QFH15_08340) | - | 1676865..1677461 (+) | 597 | WP_223131915.1 | recombination protein NinG | - |
| QFH15_RS08345 (QFH15_08345) | - | 1677463..1677924 (+) | 462 | WP_014391474.1 | antiterminator Q family protein | - |
| QFH15_RS08355 (QFH15_08355) | - | 1678251..1678616 (+) | 366 | WP_223131916.1 | phage holin, lambda family | - |
| QFH15_RS08360 (QFH15_08360) | - | 1678588..1679172 (+) | 585 | WP_223131917.1 | glycoside hydrolase family 19 protein | - |
| QFH15_RS08365 (QFH15_08365) | - | 1679175..1679498 (+) | 324 | WP_223131941.1 | DUF2570 family protein | - |
| QFH15_RS08370 (QFH15_08370) | - | 1679512..1679685 (+) | 174 | WP_227718007.1 | lytic protein Rz1 | - |
| QFH15_RS08375 (QFH15_08375) | - | 1679723..1680139 (-) | 417 | WP_108511501.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| QFH15_RS08380 (QFH15_08380) | - | 1680185..1680364 (-) | 180 | WP_277883190.1 | type II toxin-antitoxin system HicA family toxin | - |
| QFH15_RS08385 (QFH15_08385) | - | 1680620..1681096 (+) | 477 | WP_075269225.1 | DUF1441 family protein | - |
| QFH15_RS08390 (QFH15_08390) | - | 1681099..1683207 (+) | 2109 | WP_223131943.1 | phage terminase large subunit family protein | - |
| QFH15_RS08395 (QFH15_08395) | - | 1683204..1683425 (+) | 222 | WP_014391481.1 | hypothetical protein | - |
| QFH15_RS08400 (QFH15_08400) | - | 1683422..1684960 (+) | 1539 | WP_223131944.1 | phage portal protein | - |
| QFH15_RS08405 (QFH15_08405) | - | 1684896..1686914 (+) | 2019 | WP_223131945.1 | ClpP-like prohead protease/major capsid protein fusion protein | - |
| QFH15_RS08410 (QFH15_08410) | - | 1686985..1687311 (+) | 327 | WP_223131946.1 | capsid cement protein | - |
| QFH15_RS08415 (QFH15_08415) | - | 1687304..1687597 (+) | 294 | WP_005719722.1 | hypothetical protein | - |
| QFH15_RS08420 (QFH15_08420) | - | 1687597..1688148 (+) | 552 | WP_223131947.1 | phage tail protein | - |
| QFH15_RS08425 (QFH15_08425) | - | 1688145..1688552 (+) | 408 | WP_223131948.1 | phage minor tail U family protein | - |
| QFH15_RS08430 (QFH15_08430) | - | 1688549..1689058 (+) | 510 | WP_108511496.1 | phage tail tube protein | - |
| QFH15_RS08435 (QFH15_08435) | - | 1689061..1689450 (+) | 390 | WP_139616925.1 | phage minor tail protein G | - |
| QFH15_RS08440 (QFH15_08440) | - | 1689471..1689773 (+) | 303 | WP_225529681.1 | phage tail assembly protein T | - |
| QFH15_RS08445 (QFH15_08445) | - | 1689760..1692129 (+) | 2370 | WP_223131949.1 | phage tail length tape measure family protein | - |
| QFH15_RS08450 (QFH15_08450) | - | 1692132..1692590 (+) | 459 | WP_223131950.1 | phage tail protein | - |
| QFH15_RS08455 (QFH15_08455) | - | 1692583..1693395 (+) | 813 | WP_223131951.1 | collagen-like protein | - |
| QFH15_RS08460 (QFH15_08460) | - | 1693407..1694009 (+) | 603 | WP_223131952.1 | hypothetical protein | - |
| QFH15_RS08465 (QFH15_08465) | - | 1694006..1694464 (+) | 459 | WP_223131953.1 | enoyl-CoA hydratase | - |
| QFH15_RS08470 (QFH15_08470) | - | 1694461..1695165 (+) | 705 | WP_223131954.1 | phage minor tail protein L | - |
| QFH15_RS08475 (QFH15_08475) | - | 1695193..1695540 (+) | 348 | WP_223131955.1 | hypothetical protein | - |
| QFH15_RS08480 (QFH15_08480) | - | 1695598..1696341 (+) | 744 | WP_223131956.1 | C40 family peptidase | - |
| QFH15_RS08485 (QFH15_08485) | - | 1696284..1696904 (+) | 621 | WP_014667799.1 | tail assembly protein | - |
| QFH15_RS08490 (QFH15_08490) | - | 1696908..1700249 (+) | 3342 | WP_223131957.1 | phage tail protein | - |
| QFH15_RS08495 (QFH15_08495) | - | 1700296..1700622 (+) | 327 | WP_223131958.1 | hypothetical protein | - |
| QFH15_RS08500 (QFH15_08500) | - | 1700659..1701612 (-) | 954 | WP_223131959.1 | site-specific integrase | - |
| QFH15_RS08505 (QFH15_08505) | - | 1701609..1701998 (-) | 390 | WP_223131960.1 | DUF1870 family protein | - |
| QFH15_RS08510 (QFH15_08510) | - | 1702052..1702291 (-) | 240 | WP_223131961.1 | hypothetical protein | - |
| QFH15_RS08515 (QFH15_08515) | - | 1702978..1703397 (+) | 420 | WP_005719426.1 | DUF417 family protein | - |
| QFH15_RS08520 (QFH15_08520) | lipA | 1703475..1704437 (-) | 963 | WP_005755556.1 | lipoyl synthase | - |
| QFH15_RS08525 (QFH15_08525) | lipB | 1704502..1705158 (-) | 657 | WP_156732385.1 | lipoyl(octanoyl) transferase LipB | - |
| QFH15_RS08530 (QFH15_08530) | ybeD | 1705165..1705461 (-) | 297 | WP_005719420.1 | DUF493 family protein YbeD | - |
| QFH15_RS08535 (QFH15_08535) | - | 1705564..1706748 (-) | 1185 | WP_005752389.1 | serine hydrolase | - |
| QFH15_RS08540 (QFH15_08540) | - | 1706775..1707659 (-) | 885 | WP_005755551.1 | septal ring lytic transglycosylase RlpA family protein | - |
Sequence
Protein
Download Length: 166 a.a. Molecular weight: 18657.68 Da Isoelectric Point: 5.3353
>NTDB_id=821695 QFH15_RS08155 WP_005725039.1 1657032..1657532(+) (ssb) [Pasteurella multocida strain 19BRD-057]
MAGVNKVIIVGNLGNDPEIRTMPNGEAVANISVATSESWIDKNTNERREVTEWHRIVFYRRQAEVAGEYLRKGSKVYVEG
RLKTRKWQDQNGQDRYTTEIQGDVLQMLDSRNERQQTGGYAPQTAAPQYNAPTGGYGAQPSRPATKPAPQNEPPMDMGFE
EDNIPF
MAGVNKVIIVGNLGNDPEIRTMPNGEAVANISVATSESWIDKNTNERREVTEWHRIVFYRRQAEVAGEYLRKGSKVYVEG
RLKTRKWQDQNGQDRYTTEIQGDVLQMLDSRNERQQTGGYAPQTAAPQYNAPTGGYGAQPSRPATKPAPQNEPPMDMGFE
EDNIPF
Nucleotide
Download Length: 501 bp
>NTDB_id=821695 QFH15_RS08155 WP_005725039.1 1657032..1657532(+) (ssb) [Pasteurella multocida strain 19BRD-057]
ATGGCTGGAGTAAATAAAGTAATTATTGTAGGGAACTTAGGTAACGATCCTGAAATCCGCACAATGCCAAATGGTGAAGC
CGTAGCCAATATCAGCGTCGCGACCAGTGAAAGCTGGATCGACAAAAATACTAACGAACGTCGTGAAGTCACCGAATGGC
ATCGCATCGTATTCTACCGTCGTCAAGCTGAAGTGGCTGGGGAATATCTGCGTAAAGGTTCAAAAGTGTATGTAGAAGGA
CGCCTCAAAACCCGTAAATGGCAAGACCAAAATGGGCAAGATCGCTACACTACCGAAATCCAAGGCGACGTGTTACAAAT
GCTCGACAGCCGTAACGAACGTCAACAAACCGGCGGCTACGCCCCACAAACCGCTGCGCCACAATATAATGCCCCAACAG
GTGGCTACGGTGCACAACCTTCTCGTCCAGCGACAAAACCCGCTCCACAAAACGAACCTCCAATGGACATGGGCTTTGAG
GAAGATAATATTCCGTTTTAA
ATGGCTGGAGTAAATAAAGTAATTATTGTAGGGAACTTAGGTAACGATCCTGAAATCCGCACAATGCCAAATGGTGAAGC
CGTAGCCAATATCAGCGTCGCGACCAGTGAAAGCTGGATCGACAAAAATACTAACGAACGTCGTGAAGTCACCGAATGGC
ATCGCATCGTATTCTACCGTCGTCAAGCTGAAGTGGCTGGGGAATATCTGCGTAAAGGTTCAAAAGTGTATGTAGAAGGA
CGCCTCAAAACCCGTAAATGGCAAGACCAAAATGGGCAAGATCGCTACACTACCGAAATCCAAGGCGACGTGTTACAAAT
GCTCGACAGCCGTAACGAACGTCAACAAACCGGCGGCTACGCCCCACAAACCGCTGCGCCACAATATAATGCCCCAACAG
GTGGCTACGGTGCACAACCTTCTCGTCCAGCGACAAAACCCGCTCCACAAAACGAACCTCCAATGGACATGGGCTTTGAG
GAAGATAATATTCCGTTTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
69.231 |
100 |
0.759 |
| ssb | Vibrio cholerae strain A1552 |
53.591 |
100 |
0.584 |
| ssb | Neisseria meningitidis MC58 |
44.068 |
100 |
0.47 |
| ssb | Neisseria gonorrhoeae MS11 |
44.068 |
100 |
0.47 |