Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   QAY75_RS13620 Genome accession   NZ_CP123168
Coordinates   2746901..2747371 (+) Length   156 a.a.
NCBI ID   WP_000934759.1    Uniprot ID   A0A2I7Y8V1
Organism   Staphylococcus aureus strain BE-MSSA4     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2723564..2752316 2746901..2747371 within 0


Gene organization within MGE regions


Location: 2723564..2752316
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QAY75_RS13475 (QAY75_13500) - 2723564..2724190 (-) 627 WP_000522381.1 nitroreductase family protein -
  QAY75_RS13480 (QAY75_13505) - 2724387..2725646 (+) 1260 WP_000120297.1 SdrH family protein -
  QAY75_RS13485 (QAY75_13510) mroQ 2725671..2726414 (-) 744 WP_000197635.1 CPBP family intramembrane glutamic endopeptidase MroQ -
  QAY75_RS13490 (QAY75_13515) groES 2726589..2726873 (+) 285 WP_000917289.1 co-chaperone GroES -
  QAY75_RS13495 (QAY75_13520) groL 2726949..2728565 (+) 1617 WP_000240642.1 chaperonin GroEL -
  QAY75_RS13500 (QAY75_13525) - 2729105..2730412 (-) 1308 WP_001045079.1 TrkH family potassium uptake protein -
  QAY75_RS13505 (QAY75_13530) - 2730856..2732079 (-) 1224 WP_000206625.1 ArgE/DapE family deacylase -
  QAY75_RS13510 (QAY75_13535) lukH 2732515..2733570 (+) 1056 WP_000791411.1 bi-component leukocidin LukGH subunit H -
  QAY75_RS13515 (QAY75_13540) lukG 2733592..2734608 (+) 1017 WP_000595392.1 bi-component leukocidin LukGH subunit G -
  QAY75_RS13520 (QAY75_13545) sph 2734846..2735670 (-) 825 Protein_2622 sphingomyelin phosphodiesterase -
  QAY75_RS13525 (QAY75_13550) - 2735727..2736764 (-) 1038 WP_001814397.1 tyrosine-type recombinase/integrase -
  QAY75_RS13530 (QAY75_13555) - 2736957..2737661 (-) 705 WP_000440838.1 type II toxin-antitoxin system PemK/MazF family toxin -
  QAY75_RS13535 (QAY75_13560) - 2737801..2737968 (-) 168 WP_000705238.1 hypothetical protein -
  QAY75_RS13540 (QAY75_13565) - 2738124..2738822 (-) 699 WP_000837517.1 potassium channel family protein -
  QAY75_RS13545 (QAY75_13570) - 2739004..2739636 (-) 633 WP_031763806.1 LexA family transcriptional regulator -
  QAY75_RS13550 (QAY75_13575) - 2739790..2740017 (+) 228 WP_000192116.1 helix-turn-helix transcriptional regulator -
  QAY75_RS13555 (QAY75_13580) - 2740040..2740828 (+) 789 WP_031763800.1 phage antirepressor -
  QAY75_RS13560 (QAY75_13585) - 2740845..2741039 (+) 195 WP_001566738.1 hypothetical protein -
  QAY75_RS13565 (QAY75_13590) - 2741034..2741390 (-) 357 WP_000768245.1 DUF2513 domain-containing protein -
  QAY75_RS13570 (QAY75_13595) - 2741440..2741631 (+) 192 WP_000389905.1 hypothetical protein -
  QAY75_RS13575 (QAY75_13600) - 2741633..2741860 (-) 228 WP_000801108.1 hypothetical protein -
  QAY75_RS13580 (QAY75_13605) - 2741919..2742239 (+) 321 WP_001120935.1 DUF771 domain-containing protein -
  QAY75_RS13585 (QAY75_13610) - 2742236..2742397 (+) 162 WP_000066014.1 DUF1270 domain-containing protein -
  QAY75_RS13590 (QAY75_13615) - 2742490..2742792 (+) 303 WP_031807559.1 DUF2482 family protein -
  QAY75_RS13595 (QAY75_13620) - 2742796..2743056 (+) 261 WP_031807558.1 DUF1108 family protein -
  QAY75_RS13600 (QAY75_13625) - 2743065..2743328 (+) 264 WP_001205732.1 hypothetical protein -
  QAY75_RS13605 (QAY75_13630) - 2743337..2745280 (+) 1944 WP_031928235.1 AAA family ATPase -
  QAY75_RS13610 (QAY75_13635) - 2745282..2746202 (+) 921 WP_000138475.1 recombinase RecT -
  QAY75_RS13615 (QAY75_13640) - 2746283..2746900 (+) 618 WP_071621397.1 MBL fold metallo-hydrolase -
  QAY75_RS13620 (QAY75_13645) ssbA 2746901..2747371 (+) 471 WP_000934759.1 single-stranded DNA-binding protein Machinery gene
  QAY75_RS13625 (QAY75_13650) - 2747401..2748285 (+) 885 WP_000148300.1 DnaD domain protein -
  QAY75_RS13630 (QAY75_13655) - 2748292..2748510 (+) 219 WP_000338530.1 hypothetical protein -
  QAY75_RS13635 (QAY75_13660) - 2748519..2748923 (+) 405 WP_000401960.1 RusA family crossover junction endodeoxyribonuclease -
  QAY75_RS13640 (QAY75_13665) - 2748936..2749307 (+) 372 WP_031928234.1 SA1788 family PVL leukocidin-associated protein -
  QAY75_RS13645 (QAY75_13670) - 2749308..2749556 (+) 249 WP_031928233.1 phi PVL orf 51-like protein -
  QAY75_RS13650 (QAY75_13675) - 2749597..2749845 (+) 249 WP_031889594.1 DUF1024 family protein -
  QAY75_RS13655 (QAY75_13680) - 2749838..2750347 (+) 510 WP_000185636.1 dUTP diphosphatase -
  QAY75_RS13660 (QAY75_13685) - 2750384..2750629 (+) 246 WP_001282074.1 hypothetical protein -
  QAY75_RS13665 (QAY75_13690) - 2750626..2750814 (+) 189 WP_000195782.1 DUF1381 domain-containing protein -
  QAY75_RS13670 (QAY75_13695) - 2750789..2750989 (+) 201 WP_001125015.1 hypothetical protein -
  QAY75_RS13675 (QAY75_13700) rinB 2750992..2751141 (+) 150 WP_000237868.1 transcriptional activator RinB -
  QAY75_RS13680 (QAY75_13705) - 2751141..2751341 (+) 201 WP_000265043.1 DUF1514 family protein -
  QAY75_RS13685 (QAY75_13710) - 2751369..2751785 (+) 417 WP_000590122.1 hypothetical protein -
  QAY75_RS13690 (QAY75_13715) - 2752017..2752316 (+) 300 WP_000988330.1 HNH endonuclease -

Sequence


Protein


Download         Length: 156 a.a.        Molecular weight: 17641.52 Da        Isoelectric Point: 5.2672

>NTDB_id=819932 QAY75_RS13620 WP_000934759.1 2746901..2747371(+) (ssbA) [Staphylococcus aureus strain BE-MSSA4]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=819932 QAY75_RS13620 WP_000934759.1 2746901..2747371(+) (ssbA) [Staphylococcus aureus strain BE-MSSA4]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGGACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCGGTTAACCGTACATTTACGAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A2I7Y8V1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

55.932

100

0.635

  ssb Latilactobacillus sakei subsp. sakei 23K

50.588

100

0.551

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

67.949

0.404

  ssb Glaesserella parasuis strain SC1401

32.203

100

0.365