Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   QAO17_RS14035 Genome accession   NZ_CP123134
Coordinates   2818695..2819165 (+) Length   156 a.a.
NCBI ID   WP_000610647.1    Uniprot ID   -
Organism   Staphylococcus aureus strain GE-MRSA25     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2801145..2825878 2818695..2819165 within 0


Gene organization within MGE regions


Location: 2801145..2825878
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QAO17_RS13905 (QAO17_13900) - 2801145..2801990 (+) 846 WP_000812008.1 class I SAM-dependent methyltransferase -
  QAO17_RS13910 (QAO17_13905) - 2802362..2803585 (-) 1224 WP_411897067.1 ArgE/DapE family deacylase -
  QAO17_RS13915 (QAO17_13910) lukH 2804020..2805072 (+) 1053 WP_000791416.1 bi-component leukocidin LukGH subunit H -
  QAO17_RS13920 (QAO17_13915) lukG 2805094..2806110 (+) 1017 WP_000595402.1 bi-component leukocidin LukGH subunit G -
  QAO17_RS13925 (QAO17_13920) sph 2806348..2807172 (-) 825 Protein_2705 sphingomyelin phosphodiesterase -
  QAO17_RS13930 (QAO17_13925) - 2807229..2808266 (-) 1038 WP_000857198.1 tyrosine-type recombinase/integrase -
  QAO17_RS13935 (QAO17_13930) - 2808457..2809170 (-) 714 WP_001549185.1 type II toxin-antitoxin system PemK/MazF family toxin -
  QAO17_RS13940 (QAO17_13935) - 2809248..2809430 (-) 183 WP_000705236.1 hypothetical protein -
  QAO17_RS13945 (QAO17_13940) - 2809501..2809686 (-) 186 WP_000109189.1 hypothetical protein -
  QAO17_RS13950 (QAO17_13945) - 2809683..2809829 (-) 147 WP_000345949.1 hypothetical protein -
  QAO17_RS13955 (QAO17_13950) - 2809903..2810757 (-) 855 WP_001557601.1 HIRAN domain-containing protein -
  QAO17_RS13960 (QAO17_13955) - 2810769..2811485 (-) 717 WP_001083975.1 LexA family transcriptional regulator -
  QAO17_RS13965 (QAO17_13960) - 2811649..2811891 (+) 243 WP_000639923.1 DUF739 family protein -
  QAO17_RS13970 (QAO17_13965) - 2811904..2812350 (+) 447 WP_000435349.1 hypothetical protein -
  QAO17_RS13975 (QAO17_13970) - 2812365..2812505 (+) 141 WP_000939495.1 hypothetical protein -
  QAO17_RS13980 (QAO17_13975) - 2812498..2812707 (-) 210 WP_000772137.1 hypothetical protein -
  QAO17_RS13985 (QAO17_13980) - 2812764..2813513 (+) 750 WP_001148590.1 phage antirepressor KilAC domain-containing protein -
  QAO17_RS13990 (QAO17_13985) - 2813526..2813786 (+) 261 WP_000435343.1 hypothetical protein -
  QAO17_RS13995 (QAO17_13990) - 2813810..2813965 (-) 156 Protein_2719 hypothetical protein -
  QAO17_RS14000 (QAO17_13995) - 2814019..2814339 (+) 321 WP_001120936.1 DUF771 domain-containing protein -
  QAO17_RS14005 (QAO17_14000) - 2814336..2814497 (+) 162 WP_000066011.1 DUF1270 domain-containing protein -
  QAO17_RS14010 (QAO17_14005) - 2814590..2814850 (+) 261 WP_000291488.1 DUF1108 family protein -
  QAO17_RS14015 (QAO17_14010) - 2814859..2815122 (+) 264 WP_001205732.1 hypothetical protein -
  QAO17_RS14020 (QAO17_14015) - 2815131..2817074 (+) 1944 WP_000700571.1 AAA family ATPase -
  QAO17_RS14025 (QAO17_14020) - 2817076..2817996 (+) 921 WP_000138481.1 recombinase RecT -
  QAO17_RS14030 (QAO17_14025) - 2818077..2818694 (+) 618 WP_072528355.1 MBL fold metallo-hydrolase -
  QAO17_RS14035 (QAO17_14030) ssbA 2818695..2819165 (+) 471 WP_000610647.1 single-stranded DNA-binding protein Machinery gene
  QAO17_RS14040 (QAO17_14035) - 2819195..2820112 (+) 918 WP_041497902.1 DnaD domain protein -
  QAO17_RS14045 (QAO17_14040) - 2820119..2820337 (+) 219 WP_000338528.1 hypothetical protein -
  QAO17_RS14050 (QAO17_14045) - 2820346..2820750 (+) 405 WP_000401966.1 RusA family crossover junction endodeoxyribonuclease -
  QAO17_RS14055 (QAO17_14050) - 2820763..2821131 (+) 369 WP_000101270.1 SA1788 family PVL leukocidin-associated protein -
  QAO17_RS14060 (QAO17_14055) - 2821135..2821377 (+) 243 WP_000131377.1 phi PVL orf 51-like protein -
  QAO17_RS14065 (QAO17_14060) - 2821391..2821777 (+) 387 WP_000693615.1 hypothetical protein -
  QAO17_RS14070 (QAO17_14065) - 2821774..2821968 (+) 195 WP_000983954.1 hypothetical protein -
  QAO17_RS14075 (QAO17_14070) - 2821965..2822414 (+) 450 WP_000982708.1 YopX family protein -
  QAO17_RS14080 (QAO17_14075) - 2822411..2822695 (+) 285 WP_001105621.1 hypothetical protein -
  QAO17_RS14085 (QAO17_14080) - 2822688..2822942 (+) 255 WP_001065084.1 DUF1024 family protein -
  QAO17_RS14090 (QAO17_14085) - 2822929..2823099 (+) 171 WP_000714409.1 hypothetical protein -
  QAO17_RS14095 (QAO17_14090) - 2823092..2823625 (+) 534 WP_000185642.1 dUTP diphosphatase -
  QAO17_RS14100 (QAO17_14095) - 2823662..2823949 (+) 288 WP_000195809.1 DUF1381 domain-containing protein -
  QAO17_RS14105 (QAO17_14100) - 2823942..2824178 (+) 237 WP_000608280.1 hypothetical protein -
  QAO17_RS14110 (QAO17_14105) - 2824168..2824557 (+) 390 WP_170267442.1 hypothetical protein -
  QAO17_RS14115 (QAO17_14110) rinB 2824554..2824703 (+) 150 WP_000595265.1 transcriptional activator RinB -
  QAO17_RS14120 (QAO17_14115) - 2824703..2824903 (+) 201 WP_000265043.1 DUF1514 family protein -
  QAO17_RS14125 (QAO17_14120) - 2824931..2825347 (+) 417 WP_000590122.1 hypothetical protein -
  QAO17_RS14130 (QAO17_14125) - 2825579..2825878 (+) 300 WP_000988333.1 HNH endonuclease -

Sequence


Protein


Download         Length: 156 a.a.        Molecular weight: 17641.52 Da        Isoelectric Point: 5.2672

>NTDB_id=819337 QAO17_RS14035 WP_000610647.1 2818695..2819165(+) (ssbA) [Staphylococcus aureus strain GE-MRSA25]
MINRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=819337 QAO17_RS14035 WP_000610647.1 2818695..2819165(+) (ssbA) [Staphylococcus aureus strain GE-MRSA25]
ATGATAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGCAGATTACAAACGCGT
AACTATGAAAACAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAGTTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

55.367

100

0.628

  ssb Latilactobacillus sakei subsp. sakei 23K

51.176

100

0.558

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

67.949

0.404

  ssb Glaesserella parasuis strain SC1401

32.203

100

0.365