Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | QAY70_RS13655 | Genome accession | NZ_CP123099 |
| Coordinates | 2756033..2756503 (+) | Length | 156 a.a. |
| NCBI ID | WP_000610648.1 | Uniprot ID | A0A090M1W2 |
| Organism | Staphylococcus aureus strain IT-MSSA55 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2734923..2761835 | 2756033..2756503 | within | 0 |
Gene organization within MGE regions
Location: 2734923..2761835
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QAY70_RS13520 (QAY70_13510) | groES | 2734923..2735207 (+) | 285 | WP_000917289.1 | co-chaperone GroES | - |
| QAY70_RS13525 (QAY70_13515) | groL | 2735283..2736899 (+) | 1617 | WP_000240642.1 | chaperonin GroEL | - |
| QAY70_RS13530 (QAY70_13520) | - | 2737433..2738740 (-) | 1308 | WP_001045085.1 | TrkH family potassium uptake protein | - |
| QAY70_RS13535 (QAY70_13525) | - | 2738901..2739812 (+) | 912 | WP_000825510.1 | iron-hydroxamate ABC transporter substrate-binding protein | - |
| QAY70_RS13540 (QAY70_13530) | - | 2739874..2740720 (+) | 847 | Protein_2625 | class I SAM-dependent methyltransferase | - |
| QAY70_RS13545 (QAY70_13535) | - | 2741092..2742315 (-) | 1224 | WP_000206621.1 | ArgE/DapE family deacylase | - |
| QAY70_RS13550 (QAY70_13540) | lukH | 2742751..2743803 (+) | 1053 | WP_000791419.1 | bi-component leukocidin LukGH subunit H | - |
| QAY70_RS13555 (QAY70_13545) | lukG | 2743825..2744841 (+) | 1017 | WP_000595326.1 | bi-component leukocidin LukGH subunit G | - |
| QAY70_RS13560 (QAY70_13550) | sph | 2745079..2745903 (-) | 825 | Protein_2629 | sphingomyelin phosphodiesterase | - |
| QAY70_RS13565 (QAY70_13555) | - | 2745960..2746997 (-) | 1038 | WP_000857191.1 | tyrosine-type recombinase/integrase | - |
| QAY70_RS13570 (QAY70_13560) | - | 2747056..2747520 (-) | 465 | WP_000825947.1 | hypothetical protein | - |
| QAY70_RS13575 (QAY70_13565) | - | 2747620..2747802 (-) | 183 | WP_000705248.1 | hypothetical protein | - |
| QAY70_RS13580 (QAY70_13570) | - | 2748006..2748347 (-) | 342 | WP_000591749.1 | hypothetical protein | - |
| QAY70_RS13585 (QAY70_13575) | - | 2748353..2749285 (-) | 933 | WP_000759682.1 | exonuclease domain-containing protein | - |
| QAY70_RS13590 (QAY70_13580) | - | 2749301..2750014 (-) | 714 | WP_001031454.1 | XRE family transcriptional regulator | - |
| QAY70_RS13595 (QAY70_13585) | - | 2749977..2750150 (+) | 174 | WP_001801500.1 | hypothetical protein | - |
| QAY70_RS13600 (QAY70_13590) | - | 2750147..2750410 (+) | 264 | WP_000854073.1 | helix-turn-helix transcriptional regulator | - |
| QAY70_RS13605 (QAY70_13595) | - | 2750426..2750623 (+) | 198 | WP_001148862.1 | hypothetical protein | - |
| QAY70_RS13610 (QAY70_13600) | - | 2750610..2750990 (-) | 381 | WP_000762519.1 | DUF2513 domain-containing protein | - |
| QAY70_RS13615 (QAY70_13605) | - | 2751045..2751368 (+) | 324 | WP_001120201.1 | DUF771 domain-containing protein | - |
| QAY70_RS13620 (QAY70_13610) | - | 2751365..2751526 (+) | 162 | WP_000048129.1 | DUF1270 family protein | - |
| QAY70_RS13625 (QAY70_13615) | - | 2751621..2751923 (+) | 303 | WP_000165371.1 | DUF2482 family protein | - |
| QAY70_RS13630 (QAY70_13620) | - | 2751928..2752188 (+) | 261 | WP_000291510.1 | DUF1108 family protein | - |
| QAY70_RS13635 (QAY70_13625) | - | 2752197..2752460 (+) | 264 | WP_001205732.1 | hypothetical protein | - |
| QAY70_RS13640 (QAY70_13630) | - | 2752469..2754412 (+) | 1944 | WP_000700555.1 | AAA family ATPase | - |
| QAY70_RS13645 (QAY70_13635) | - | 2754414..2755334 (+) | 921 | WP_000138474.1 | recombinase RecT | - |
| QAY70_RS13650 (QAY70_13640) | - | 2755415..2756032 (+) | 618 | WP_073394849.1 | MBL fold metallo-hydrolase | - |
| QAY70_RS13655 (QAY70_13645) | ssbA | 2756033..2756503 (+) | 471 | WP_000610648.1 | single-stranded DNA-binding protein | Machinery gene |
| QAY70_RS13660 (QAY70_13650) | - | 2756533..2757426 (+) | 894 | WP_000148321.1 | DnaD domain protein | - |
| QAY70_RS13665 (QAY70_13655) | - | 2757433..2757651 (+) | 219 | WP_000338530.1 | hypothetical protein | - |
| QAY70_RS13670 (QAY70_13660) | - | 2757660..2758064 (+) | 405 | WP_000401960.1 | RusA family crossover junction endodeoxyribonuclease | - |
| QAY70_RS13675 (QAY70_13665) | - | 2758077..2758445 (+) | 369 | WP_000101288.1 | SA1788 family PVL leukocidin-associated protein | - |
| QAY70_RS13680 (QAY70_13670) | - | 2758449..2758691 (+) | 243 | WP_000131370.1 | SAV1978 family virulence-associated passenger protein | - |
| QAY70_RS13685 (QAY70_13675) | - | 2758706..2758960 (+) | 255 | WP_001065097.1 | DUF1024 family protein | - |
| QAY70_RS13690 (QAY70_13680) | - | 2758947..2759117 (+) | 171 | WP_000714403.1 | hypothetical protein | - |
| QAY70_RS13695 (QAY70_13685) | - | 2759110..2759646 (+) | 537 | WP_001066447.1 | dUTP diphosphatase | - |
| QAY70_RS13700 (QAY70_13690) | - | 2759683..2759928 (+) | 246 | WP_001282074.1 | hypothetical protein | - |
| QAY70_RS13705 (QAY70_13695) | - | 2759925..2760131 (+) | 207 | WP_000195803.1 | DUF1381 domain-containing protein | - |
| QAY70_RS13710 (QAY70_13700) | - | 2760128..2760514 (+) | 387 | WP_000592207.1 | hypothetical protein | - |
| QAY70_RS13715 (QAY70_13705) | rinB | 2760511..2760660 (+) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| QAY70_RS13720 (QAY70_13710) | - | 2760660..2760860 (+) | 201 | WP_001622114.1 | DUF1514 family protein | - |
| QAY70_RS13725 (QAY70_13715) | - | 2760888..2761304 (+) | 417 | WP_000590122.1 | hypothetical protein | - |
| QAY70_RS13730 (QAY70_13720) | - | 2761536..2761835 (+) | 300 | WP_000988336.1 | HNH endonuclease | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17641.52 Da Isoelectric Point: 5.2672
>NTDB_id=818709 QAY70_RS13655 WP_000610648.1 2756033..2756503(+) (ssbA) [Staphylococcus aureus strain IT-MSSA55]
MINRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
MINRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=818709 QAY70_RS13655 WP_000610648.1 2756033..2756503(+) (ssbA) [Staphylococcus aureus strain IT-MSSA55]
ATGATAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGGACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
ATGATAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGGACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.367 |
100 |
0.628 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.176 |
100 |
0.558 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.768 |
100 |
0.372 |