Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   QAY74_RS13980 Genome accession   NZ_CP123093
Coordinates   2813299..2813769 (+) Length   156 a.a.
NCBI ID   WP_000610647.1    Uniprot ID   -
Organism   Staphylococcus aureus strain MRSA-EDCC5443     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2784670..2820482 2813299..2813769 within 0


Gene organization within MGE regions


Location: 2784670..2820482
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QAY74_RS13790 (QAY74_13775) - 2784670..2785296 (-) 627 WP_000522384.1 nitroreductase family protein -
  QAY74_RS13795 (QAY74_13780) - 2785493..2786740 (+) 1248 WP_052997535.1 SdrH family protein -
  QAY74_RS13800 (QAY74_13785) mroQ 2786764..2787507 (-) 744 WP_000197645.1 CPBP family intramembrane glutamic endopeptidase MroQ -
  QAY74_RS13805 (QAY74_13790) groES 2787684..2787968 (+) 285 WP_000917289.1 co-chaperone GroES -
  QAY74_RS13810 (QAY74_13795) groL 2788044..2789660 (+) 1617 WP_000240649.1 chaperonin GroEL -
  QAY74_RS13815 (QAY74_13800) - 2789755..2790301 (-) 547 Protein_2683 site-specific integrase -
  QAY74_RS13820 (QAY74_13805) - 2790362..2790574 (+) 213 WP_000128898.1 LuxR C-terminal-related transcriptional regulator -
  QAY74_RS13825 (QAY74_13810) - 2790571..2791161 (+) 591 WP_001293059.1 terminase small subunit -
  QAY74_RS13830 (QAY74_13815) - 2791478..2791915 (+) 438 WP_075583719.1 hypothetical protein -
  QAY74_RS13835 (QAY74_13820) - 2792021..2792464 (+) 444 WP_000022887.1 GNAT family N-acetyltransferase -
  QAY74_RS13840 (QAY74_13825) - 2793307..2794614 (-) 1308 WP_001045063.1 TrkH family potassium uptake protein -
  QAY74_RS13845 (QAY74_13830) - 2794775..2795686 (+) 912 WP_000825510.1 iron-hydroxamate ABC transporter substrate-binding protein -
  QAY74_RS13850 (QAY74_13835) - 2795748..2796593 (+) 846 WP_000812008.1 class I SAM-dependent methyltransferase -
  QAY74_RS13855 (QAY74_13840) - 2796965..2798188 (-) 1224 WP_000206641.1 ArgE/DapE family deacylase -
  QAY74_RS13860 (QAY74_13845) lukH 2798623..2799675 (+) 1053 WP_000791416.1 bi-component leukocidin LukGH subunit H -
  QAY74_RS13865 (QAY74_13850) lukG 2799697..2800713 (+) 1017 WP_000595402.1 bi-component leukocidin LukGH subunit G -
  QAY74_RS13870 (QAY74_13855) sph 2800951..2801779 (-) 829 Protein_2694 sphingomyelin phosphodiesterase -
  QAY74_RS13875 (QAY74_13860) - 2801833..2802870 (-) 1038 WP_000857198.1 tyrosine-type recombinase/integrase -
  QAY74_RS13880 (QAY74_13865) - 2803061..2803774 (-) 714 WP_001549185.1 type II toxin-antitoxin system PemK/MazF family toxin -
  QAY74_RS13885 (QAY74_13870) - 2803852..2804034 (-) 183 WP_000705236.1 hypothetical protein -
  QAY74_RS13890 (QAY74_13875) - 2804105..2804290 (-) 186 WP_000109189.1 hypothetical protein -
  QAY74_RS13895 (QAY74_13880) - 2804287..2804433 (-) 147 WP_000345949.1 hypothetical protein -
  QAY74_RS13900 (QAY74_13885) - 2804507..2805361 (-) 855 WP_001557601.1 HIRAN domain-containing protein -
  QAY74_RS13905 (QAY74_13890) - 2805373..2806089 (-) 717 WP_001083975.1 LexA family transcriptional regulator -
  QAY74_RS13910 (QAY74_13895) - 2806253..2806495 (+) 243 WP_000639923.1 DUF739 family protein -
  QAY74_RS13915 (QAY74_13900) - 2806508..2806954 (+) 447 WP_000435349.1 hypothetical protein -
  QAY74_RS13920 (QAY74_13905) - 2806969..2807109 (+) 141 WP_000939495.1 hypothetical protein -
  QAY74_RS13925 (QAY74_13910) - 2807102..2807311 (-) 210 WP_000772137.1 hypothetical protein -
  QAY74_RS13930 (QAY74_13915) - 2807368..2808117 (+) 750 WP_001148590.1 phage antirepressor KilAC domain-containing protein -
  QAY74_RS13935 (QAY74_13920) - 2808130..2808390 (+) 261 WP_000435343.1 hypothetical protein -
  QAY74_RS13940 (QAY74_13925) - 2808414..2808569 (-) 156 Protein_2708 hypothetical protein -
  QAY74_RS13945 (QAY74_13930) - 2808623..2808943 (+) 321 WP_001120936.1 DUF771 domain-containing protein -
  QAY74_RS13950 (QAY74_13935) - 2808940..2809101 (+) 162 WP_000066011.1 DUF1270 domain-containing protein -
  QAY74_RS13955 (QAY74_13940) - 2809194..2809454 (+) 261 WP_000291488.1 DUF1108 family protein -
  QAY74_RS13960 (QAY74_13945) - 2809463..2809726 (+) 264 WP_001205732.1 hypothetical protein -
  QAY74_RS13965 (QAY74_13950) - 2809735..2811678 (+) 1944 WP_000700571.1 AAA family ATPase -
  QAY74_RS13970 (QAY74_13955) - 2811680..2812600 (+) 921 WP_000138481.1 recombinase RecT -
  QAY74_RS13975 (QAY74_13960) - 2812681..2813298 (+) 618 WP_072528355.1 MBL fold metallo-hydrolase -
  QAY74_RS13980 (QAY74_13965) ssbA 2813299..2813769 (+) 471 WP_000610647.1 single-stranded DNA-binding protein Machinery gene
  QAY74_RS13985 (QAY74_13970) - 2813799..2814716 (+) 918 WP_041497902.1 DnaD domain protein -
  QAY74_RS13990 (QAY74_13975) - 2814723..2814941 (+) 219 WP_000338528.1 hypothetical protein -
  QAY74_RS13995 (QAY74_13980) - 2814950..2815354 (+) 405 WP_000401966.1 RusA family crossover junction endodeoxyribonuclease -
  QAY74_RS14000 (QAY74_13985) - 2815367..2815735 (+) 369 WP_000101270.1 SA1788 family PVL leukocidin-associated protein -
  QAY74_RS14005 (QAY74_13990) - 2815739..2815981 (+) 243 WP_000131377.1 phi PVL orf 51-like protein -
  QAY74_RS14010 (QAY74_13995) - 2815995..2816381 (+) 387 WP_000693615.1 hypothetical protein -
  QAY74_RS14015 (QAY74_14000) - 2816378..2816572 (+) 195 WP_000983954.1 hypothetical protein -
  QAY74_RS14020 (QAY74_14005) - 2816569..2817018 (+) 450 WP_000982708.1 YopX family protein -
  QAY74_RS14025 (QAY74_14010) - 2817015..2817299 (+) 285 WP_001105621.1 hypothetical protein -
  QAY74_RS14030 (QAY74_14015) - 2817292..2817546 (+) 255 WP_001065084.1 DUF1024 family protein -
  QAY74_RS14035 (QAY74_14020) - 2817533..2817703 (+) 171 WP_000714409.1 hypothetical protein -
  QAY74_RS14040 (QAY74_14025) - 2817696..2818229 (+) 534 WP_000185642.1 dUTP diphosphatase -
  QAY74_RS14045 (QAY74_14030) - 2818266..2818553 (+) 288 WP_000195809.1 DUF1381 domain-containing protein -
  QAY74_RS14050 (QAY74_14035) - 2818546..2818782 (+) 237 WP_000608280.1 hypothetical protein -
  QAY74_RS14055 (QAY74_14040) - 2818772..2819161 (+) 390 WP_170267442.1 hypothetical protein -
  QAY74_RS14060 (QAY74_14045) rinB 2819158..2819307 (+) 150 WP_000595265.1 transcriptional activator RinB -
  QAY74_RS14065 (QAY74_14050) - 2819307..2819507 (+) 201 WP_000265043.1 DUF1514 family protein -
  QAY74_RS14070 (QAY74_14055) - 2819535..2819951 (+) 417 WP_000590122.1 hypothetical protein -
  QAY74_RS14075 (QAY74_14060) - 2820183..2820482 (+) 300 WP_000988333.1 HNH endonuclease -

Sequence


Protein


Download         Length: 156 a.a.        Molecular weight: 17641.52 Da        Isoelectric Point: 5.2672

>NTDB_id=818581 QAY74_RS13980 WP_000610647.1 2813299..2813769(+) (ssbA) [Staphylococcus aureus strain MRSA-EDCC5443]
MINRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=818581 QAY74_RS13980 WP_000610647.1 2813299..2813769(+) (ssbA) [Staphylococcus aureus strain MRSA-EDCC5443]
ATGATAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGCAGATTACAAACGCGT
AACTATGAAAACAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAGTTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

55.367

100

0.628

  ssb Latilactobacillus sakei subsp. sakei 23K

51.176

100

0.558

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

67.949

0.404

  ssb Glaesserella parasuis strain SC1401

32.203

100

0.365