Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   QAD58_RS00745 Genome accession   NZ_CP122956
Coordinates   155326..155451 (+) Length   41 a.a.
NCBI ID   WP_050833158.1    Uniprot ID   -
Organism   Helicobacter pylori strain BT112     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 150326..160451
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QAD58_RS00720 (QAD58_00725) - 150386..152608 (+) 2223 WP_286448459.1 ATP-dependent Clp protease ATP-binding subunit -
  QAD58_RS00725 (QAD58_00730) panD 152598..152948 (+) 351 WP_286448460.1 aspartate 1-decarboxylase -
  QAD58_RS00730 (QAD58_00735) - 152959..153252 (+) 294 WP_000347916.1 YbaB/EbfC family nucleoid-associated protein -
  QAD58_RS00735 (QAD58_00740) - 153252..154247 (+) 996 WP_286448966.1 PDZ domain-containing protein -
  QAD58_RS00740 (QAD58_00745) comB6 154255..155310 (+) 1056 WP_286448969.1 P-type conjugative transfer protein TrbL Machinery gene
  QAD58_RS00745 (QAD58_00750) comB7 155326..155451 (+) 126 WP_050833158.1 hypothetical protein Machinery gene
  QAD58_RS00750 (QAD58_00755) comB8 155448..156191 (+) 744 WP_180583766.1 virB8 family protein Machinery gene
  QAD58_RS00755 (QAD58_00760) comB9 156191..157153 (+) 963 WP_286448461.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  QAD58_RS00760 (QAD58_00765) comB10 157146..158282 (+) 1137 WP_286448462.1 DNA type IV secretion system protein ComB10 Machinery gene
  QAD58_RS00765 (QAD58_00770) - 158352..159764 (+) 1413 WP_286448463.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 41 a.a.        Molecular weight: 4832.84 Da        Isoelectric Point: 9.3278

>NTDB_id=817482 QAD58_RS00745 WP_050833158.1 155326..155451(+) (comB7) [Helicobacter pylori strain BT112]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=817482 QAD58_RS00745 WP_050833158.1 155326..155451(+) (comB7) [Helicobacter pylori strain BT112]
ATGAGAATTTTTTTTGTTATTATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTAAACCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

90.244

100

0.902