Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   QAP02_RS07115 Genome accession   NZ_CP122948
Coordinates   1485920..1486033 (-) Length   37 a.a.
NCBI ID   WP_286463761.1    Uniprot ID   -
Organism   Helicobacter pylori strain BS21     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1480920..1491033
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QAP02_RS07095 (QAP02_07095) - 1481604..1483016 (-) 1413 WP_286463749.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  QAP02_RS07100 (QAP02_07100) comB10 1483086..1484216 (-) 1131 WP_286463752.1 DNA type IV secretion system protein ComB10 Machinery gene
  QAP02_RS07105 (QAP02_07105) comB9 1484209..1485180 (-) 972 WP_286463754.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  QAP02_RS07110 (QAP02_07110) comB8 1485180..1485923 (-) 744 WP_140578636.1 virB8 family protein Machinery gene
  QAP02_RS07115 (QAP02_07115) comB7 1485920..1486033 (-) 114 WP_286463761.1 comB7 lipoprotein Machinery gene
  QAP02_RS07120 (QAP02_07120) comB6 1486049..1487104 (-) 1056 WP_286464815.1 P-type conjugative transfer protein TrbL Machinery gene
  QAP02_RS07125 (QAP02_07125) - 1487112..1488107 (-) 996 WP_286464816.1 PDZ domain-containing protein -
  QAP02_RS07130 (QAP02_07130) - 1488107..1488409 (-) 303 WP_181229633.1 YbaB/EbfC family nucleoid-associated protein -
  QAP02_RS07135 (QAP02_07135) panD 1488412..1488765 (-) 354 WP_286463764.1 aspartate 1-decarboxylase -
  QAP02_RS07140 (QAP02_07140) - 1488755..1490980 (-) 2226 WP_286463766.1 ATP-dependent Clp protease ATP-binding subunit -

Sequence

Protein


Download         Length: 37 a.a.        Molecular weight: 4359.27 Da        Isoelectric Point: 9.3572

>NTDB_id=817325 QAP02_RS07115 WP_286463761.1 1485920..1486033(-) (comB7) [Helicobacter pylori strain BS21]
MRFFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=817325 QAP02_RS07115 WP_286463761.1 1485920..1486033(-) (comB7) [Helicobacter pylori strain BS21]
ATGAGATTTTTTTTTGTTATTATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGTATGAAAATAGGTTGAATCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

97.297

100

0.973