Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   R0Q54_RS01780 Genome accession   NZ_CP136992
Coordinates   304058..304231 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0ABU0V3E4
Organism   Bacillus subtilis strain J46     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 299058..309231
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  R0Q54_RS01765 (R0Q54_01765) gcvT 299857..300945 (-) 1089 WP_069964209.1 glycine cleavage system aminomethyltransferase GcvT -
  R0Q54_RS01770 (R0Q54_01770) hepAA 301387..303060 (+) 1674 WP_014480248.1 DEAD/DEAH box helicase -
  R0Q54_RS01775 (R0Q54_01775) yqhG 303081..303875 (+) 795 WP_014480249.1 YqhG family protein -
  R0Q54_RS01780 (R0Q54_01780) sinI 304058..304231 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  R0Q54_RS01785 (R0Q54_01785) sinR 304265..304600 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  R0Q54_RS01790 (R0Q54_01790) tasA 304693..305478 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  R0Q54_RS01795 (R0Q54_01795) sipW 305542..306114 (-) 573 WP_003230181.1 signal peptidase I SipW -
  R0Q54_RS01800 (R0Q54_01800) tapA 306098..306859 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  R0Q54_RS01805 (R0Q54_01805) yqzG 307131..307457 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  R0Q54_RS01810 (R0Q54_01810) spoIITA 307499..307678 (-) 180 WP_014480252.1 YqzE family protein -
  R0Q54_RS01815 (R0Q54_01815) comGG 307749..308123 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  R0Q54_RS01820 (R0Q54_01820) comGF 308124..308507 (-) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  R0Q54_RS01825 (R0Q54_01825) comGE 308533..308880 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=817282 R0Q54_RS01780 WP_003230187.1 304058..304231(+) (sinI) [Bacillus subtilis strain J46]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=817282 R0Q54_RS01780 WP_003230187.1 304058..304231(+) (sinI) [Bacillus subtilis strain J46]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1