Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB3   Type   Machinery gene
Locus tag   QAD57_RS00160 Genome accession   NZ_CP122947
Coordinates   45345..45608 (-) Length   87 a.a.
NCBI ID   WP_001177713.1    Uniprot ID   -
Organism   Helicobacter pylori strain BS07     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1303..111685 45345..45608 within 0


Gene organization within MGE regions


Location: 1303..111685
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QAD57_RS00010 (QAD57_00010) - 1650..2384 (+) 735 WP_286445820.1 Fic family protein -
  QAD57_RS00015 (QAD57_00015) - 3408..5441 (+) 2034 WP_286445821.1 relaxase/mobilization nuclease domain-containing protein -
  QAD57_RS00020 (QAD57_00020) - 6526..7597 (+) 1072 Protein_3 tyrosine-type recombinase/integrase -
  QAD57_RS00025 (QAD57_00025) ctkA 7912..8889 (-) 978 WP_015642201.1 serine/threonine-protein kinase CtkA -
  QAD57_RS00030 (QAD57_00030) - 9118..9846 (+) 729 WP_000620284.1 hypothetical protein -
  QAD57_RS00035 (QAD57_00035) - 9868..11124 (-) 1257 WP_286445822.1 hypothetical protein -
  QAD57_RS00040 (QAD57_00040) - 11121..12371 (-) 1251 WP_286445823.1 P-type conjugative transfer protein TrbL -
  QAD57_RS00045 (QAD57_00045) - 12368..13801 (-) 1434 WP_286445824.1 hypothetical protein -
  QAD57_RS00050 (QAD57_00050) - 13811..15814 (-) 2004 Protein_9 hypothetical protein -
  QAD57_RS00055 (QAD57_00055) - 15814..16881 (-) 1068 WP_286445825.1 ArdC family protein -
  QAD57_RS00060 (QAD57_00060) - 16882..17046 (-) 165 WP_286445826.1 hypothetical protein -
  QAD57_RS00065 (QAD57_00065) - 17670..18317 (+) 648 WP_286445827.1 ParA family protein -
  QAD57_RS00070 (QAD57_00070) - 18379..18756 (+) 378 WP_021308000.1 hypothetical protein -
  QAD57_RS00075 (QAD57_00075) - 18734..19306 (+) 573 WP_286445828.1 hypothetical protein -
  QAD57_RS00080 (QAD57_00080) - 19428..20231 (-) 804 WP_286445829.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
  QAD57_RS00085 (QAD57_00085) - 20203..20454 (-) 252 WP_000006537.1 hypothetical protein -
  QAD57_RS00090 (QAD57_00090) - 20505..22568 (-) 2064 WP_286445830.1 type IA DNA topoisomerase -
  QAD57_RS00095 (QAD57_00095) - 22657..28512 (-) 5856 Protein_18 SNF2-related protein -
  QAD57_RS07715 - 29091..29888 (-) 798 WP_350310569.1 helicase -
  QAD57_RS00100 (QAD57_00100) - 31313..33577 (-) 2265 WP_286445831.1 type IV secretory system conjugative DNA transfer family protein -
  QAD57_RS00105 (QAD57_00105) - 33574..34092 (-) 519 WP_286445832.1 replication regulatory RepB family protein -
  QAD57_RS00110 (QAD57_00110) - 34089..35031 (-) 943 Protein_22 CpaF/VirB11 family protein -
  QAD57_RS00115 (QAD57_00115) - 35051..35308 (-) 258 WP_286445833.1 hypothetical protein -
  QAD57_RS00120 (QAD57_00120) - 35326..36303 (-) 978 WP_286445834.1 hypothetical protein -
  QAD57_RS00125 (QAD57_00125) - 36316..38368 (-) 2053 Protein_25 collagen-like protein -
  QAD57_RS00130 (QAD57_00130) comB10 38352..39554 (-) 1203 WP_140528722.1 DNA type IV secretion system protein ComB10 Machinery gene
  QAD57_RS00135 (QAD57_00135) - 39551..41227 (-) 1677 Protein_27 TrbG/VirB9 family P-type conjugative transfer protein -
  QAD57_RS00140 (QAD57_00140) - 41224..42393 (-) 1170 WP_286445836.1 VirB8/TrbF family protein -
  QAD57_RS00145 (QAD57_00145) - 42386..42520 (-) 135 WP_000738749.1 hypothetical protein -
  QAD57_RS00150 (QAD57_00150) - 42540..45098 (-) 2559 WP_286445837.1 VirB4 family type IV secretion/conjugal transfer ATPase -
  QAD57_RS00155 (QAD57_00155) - 45098..45334 (-) 237 WP_180521129.1 hypothetical protein -
  QAD57_RS00160 (QAD57_00160) comB3 45345..45608 (-) 264 WP_001177713.1 hypothetical protein Machinery gene
  QAD57_RS00165 (QAD57_00165) comB2 45619..45903 (-) 285 WP_286445838.1 TrbC/VirB2 family protein Machinery gene
  QAD57_RS00170 (QAD57_00170) - 45900..46379 (-) 480 WP_180598625.1 hypothetical protein -
  QAD57_RS00175 (QAD57_00175) - 46483..47271 (-) 789 WP_120945486.1 integrase -
  QAD57_RS00180 (QAD57_00180) - 47319..47978 (-) 660 WP_286445839.1 DEAD/DEAH box helicase family protein -
  QAD57_RS00185 (QAD57_00185) - 48034..48168 (+) 135 WP_001146209.1 hypothetical protein -
  QAD57_RS00190 (QAD57_00190) - 48152..48836 (-) 685 Protein_38 type I restriction endonuclease -
  QAD57_RS00195 (QAD57_00195) - 48884..50779 (-) 1896 WP_286445840.1 motility associated factor glycosyltransferase family protein -
  QAD57_RS00200 (QAD57_00200) - 50805..51572 (-) 768 WP_286445841.1 TerB family tellurite resistance protein -
  QAD57_RS00205 (QAD57_00205) - 51582..51896 (-) 315 WP_024117443.1 hypothetical protein -
  QAD57_RS00210 (QAD57_00210) - 51898..53385 (-) 1488 WP_286445842.1 DUF5644 domain-containing protein -
  QAD57_RS00215 (QAD57_00215) - 53397..53897 (-) 501 WP_015645271.1 hypothetical protein -
  QAD57_RS00220 (QAD57_00220) - 53882..55618 (-) 1737 WP_286445845.1 M3 family oligoendopeptidase -
  QAD57_RS00225 (QAD57_00225) - 55718..56968 (-) 1251 WP_199492616.1 cation:proton antiporter -
  QAD57_RS00230 (QAD57_00230) - 57121..57303 (-) 183 WP_231170333.1 hypothetical protein -
  QAD57_RS00235 (QAD57_00235) - 57287..57847 (-) 561 WP_000595776.1 outer membrane beta-barrel protein -
  QAD57_RS07720 - 57891..58057 (-) 167 Protein_48 orotate phosphoribosyltransferase -
  QAD57_RS00240 (QAD57_00240) modA 58086..58837 (+) 752 Protein_49 molybdate ABC transporter substrate-binding protein -
  QAD57_RS00245 (QAD57_00245) modB 58859..59524 (+) 666 Protein_50 molybdate ABC transporter permease subunit -
  QAD57_RS00250 (QAD57_00250) - 59521..60318 (+) 798 WP_286445846.1 sulfate/molybdate ABC transporter ATP-binding protein -
  QAD57_RS00255 (QAD57_00255) - 60345..60437 (+) 93 Protein_52 metalloprotease -
  QAD57_RS00260 (QAD57_00260) gltX 60487..61878 (-) 1392 WP_286445847.1 glutamate--tRNA ligase -
  QAD57_RS00265 (QAD57_00265) hopJ 61997..63097 (+) 1101 WP_286445848.1 Hop family outer membrane protein HopJ/HopK -
  QAD57_RS00270 (QAD57_00270) - 63106..64743 (+) 1638 WP_286445849.1 class I SAM-dependent methyltransferase -
  QAD57_RS00275 (QAD57_00275) - 64709..65557 (+) 849 WP_286445850.1 glycosyltransferase family 9 protein -
  QAD57_RS00280 (QAD57_00280) typA 65603..67402 (+) 1800 WP_286445851.1 translational GTPase TypA -
  QAD57_RS00285 (QAD57_00285) - 67418..68347 (+) 930 WP_286445852.1 DNA adenine methylase -
  QAD57_RS00290 (QAD57_00290) - 68350..68973 (+) 624 WP_050831459.1 GIY-YIG nuclease family protein -
  QAD57_RS00295 (QAD57_00295) - 69068..70126 (+) 1059 WP_286445853.1 DNA cytosine methyltransferase -
  QAD57_RS00300 (QAD57_00300) - 70116..70868 (+) 753 WP_286445854.1 restriction endonuclease -
  QAD57_RS00305 (QAD57_00305) - 71105..72049 (-) 945 WP_286445855.1 catalase -
  QAD57_RS00310 (QAD57_00310) hofC 72330..73916 (+) 1587 WP_286445856.1 outer membrane beta-barrel protein HofC -
  QAD57_RS00315 (QAD57_00315) hofD 73991..75388 (+) 1398 WP_286445857.1 outer membrane beta-barrel protein HofD -
  QAD57_RS00320 (QAD57_00320) - 75580..76221 (+) 642 WP_286445858.1 hypothetical protein -
  QAD57_RS00325 (QAD57_00325) - 76245..78979 (+) 2735 Protein_66 DUF3519 domain-containing protein -
  QAD57_RS00330 (QAD57_00330) - 79492..80223 (-) 732 WP_180393783.1 NYN domain-containing protein -
  QAD57_RS00335 (QAD57_00335) ruvC 80356..80829 (+) 474 WP_001221180.1 crossover junction endodeoxyribonuclease RuvC -
  QAD57_RS00340 (QAD57_00340) - 80830..83203 (-) 2374 Protein_69 TonB-dependent receptor -
  QAD57_RS00345 (QAD57_00345) - 83526..85043 (+) 1518 WP_286445859.1 catalase -
  QAD57_RS00350 (QAD57_00350) - 85194..86069 (+) 876 WP_286445860.1 twin-arginine translocation signal domain-containing protein -
  QAD57_RS00355 (QAD57_00355) - 86154..86369 (+) 216 WP_001206520.1 hypothetical protein -
  QAD57_RS00360 (QAD57_00360) - 86427..86756 (-) 330 WP_001153399.1 zinc ribbon domain-containing protein YjdM -
  QAD57_RS00365 (QAD57_00365) cdh 86940..87838 (+) 899 Protein_74 CDP-diacylglycerol diphosphatase -
  QAD57_RS00370 (QAD57_00370) flgE 88048..90204 (+) 2157 WP_000946418.1 flagellar hook protein FlgE -
  QAD57_RS00375 (QAD57_00375) hypA 90263..90616 (+) 354 WP_000545288.1 hydrogenase/urease nickel incorporation protein HypA -
  QAD57_RS00380 (QAD57_00380) mua 90623..91084 (+) 462 WP_286445861.1 nickel-binding protein Mua -
  QAD57_RS00385 (QAD57_00385) lpxB 91084..92166 (+) 1083 WP_286445862.1 lipid-A-disaccharide synthase -
  QAD57_RS00390 (QAD57_00390) greA 92207..92701 (+) 495 WP_001031323.1 transcription elongation factor GreA -
  QAD57_RS00395 (QAD57_00395) dut 92691..93128 (+) 438 WP_000694155.1 dUTP diphosphatase -
  QAD57_RS00400 (QAD57_00400) - 93125..93781 (+) 657 WP_000022994.1 hypothetical protein -
  QAD57_RS00405 (QAD57_00405) - 93786..95438 (+) 1653 WP_286445863.1 plasminogen-binding protein pgbA C-terminal domain-containing protein -
  QAD57_RS00410 (QAD57_00410) - 95443..96114 (+) 672 WP_286445865.1 type III pantothenate kinase -
  QAD57_RS00415 (QAD57_00415) - 96105..96842 (+) 738 WP_286445866.1 sulfite exporter TauE/SafE family protein -
  QAD57_RS00420 (QAD57_00420) gmhB 96829..97353 (+) 525 WP_154404878.1 D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase -
  QAD57_RS00425 (QAD57_00425) rfaD 97362..98354 (+) 993 WP_286445868.1 ADP-glyceromanno-heptose 6-epimerase -
  QAD57_RS00430 (QAD57_00430) rfaE1 98351..99742 (+) 1392 WP_286445869.1 D-glycero-beta-D-manno-heptose-7-phosphate kinase -
  QAD57_RS00435 (QAD57_00435) gmhA 99735..100313 (+) 579 WP_286445870.1 D-sedoheptulose 7-phosphate isomerase -
  QAD57_RS00440 (QAD57_00440) guaC 100480..101457 (-) 978 WP_172417696.1 GMP reductase -
  QAD57_RS00445 (QAD57_00445) - 101705..103306 (+) 1602 WP_286445871.1 ATP-binding cassette domain-containing protein -
  QAD57_RS00450 (QAD57_00450) - 103303..104247 (+) 945 WP_286445872.1 COG2958 family protein -
  QAD57_RS00455 (QAD57_00455) - 104270..104956 (-) 687 WP_286445873.1 phosphatase PAP2 family protein -
  QAD57_RS00460 (QAD57_00460) - 104974..105161 (+) 188 Protein_93 type I restriction endonuclease -
  QAD57_RS00465 (QAD57_00465) - 105133..106722 (+) 1590 WP_286445874.1 type I restriction-modification system subunit M -
  QAD57_RS00470 (QAD57_00470) - 106715..107968 (+) 1254 WP_286445875.1 restriction endonuclease subunit S -
  QAD57_RS00475 (QAD57_00475) - 107973..110984 (+) 3012 WP_286445876.1 type I restriction endonuclease subunit R -

Sequence


Protein


Download         Length: 87 a.a.        Molecular weight: 10050.98 Da        Isoelectric Point: 6.9718

>NTDB_id=817286 QAD57_RS00160 WP_001177713.1 45345..45608(-) (comB3) [Helicobacter pylori strain BS07]
MQLVGISVSNLKEISSKEKFLWLNAKSFLIAGFIPFVMIPWLDFLNSLMLYVCFLLVFSIAEFFDEYISDILIAHSKIKT
KTNSFYA

Nucleotide


Download         Length: 264 bp        

>NTDB_id=817286 QAD57_RS00160 WP_001177713.1 45345..45608(-) (comB3) [Helicobacter pylori strain BS07]
ATGCAATTAGTCGGCATTTCAGTTTCTAATCTCAAAGAAATCAGTTCTAAAGAAAAGTTTCTTTGGCTCAATGCTAAGAG
CTTTTTAATCGCAGGATTTATTCCTTTTGTAATGATACCTTGGCTAGATTTTTTAAATTCTTTAATGCTGTATGTGTGCT
TTTTATTGGTTTTTAGCATAGCGGAGTTCTTTGATGAATATATAAGCGACATTTTAATCGCCCATTCTAAGATTAAAACC
AAAACTAATTCATTTTATGCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB3 Helicobacter pylori 26695

58.621

100

0.586