Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   R0Q54_RS01820 Genome accession   NZ_CP136992
Coordinates   308124..308507 (-) Length   127 a.a.
NCBI ID   WP_014480254.1    Uniprot ID   -
Organism   Bacillus subtilis strain J46     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 303124..313507
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  R0Q54_RS01780 (R0Q54_01780) sinI 304058..304231 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  R0Q54_RS01785 (R0Q54_01785) sinR 304265..304600 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  R0Q54_RS01790 (R0Q54_01790) tasA 304693..305478 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  R0Q54_RS01795 (R0Q54_01795) sipW 305542..306114 (-) 573 WP_003230181.1 signal peptidase I SipW -
  R0Q54_RS01800 (R0Q54_01800) tapA 306098..306859 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  R0Q54_RS01805 (R0Q54_01805) yqzG 307131..307457 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  R0Q54_RS01810 (R0Q54_01810) spoIITA 307499..307678 (-) 180 WP_014480252.1 YqzE family protein -
  R0Q54_RS01815 (R0Q54_01815) comGG 307749..308123 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  R0Q54_RS01820 (R0Q54_01820) comGF 308124..308507 (-) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  R0Q54_RS01825 (R0Q54_01825) comGE 308533..308880 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  R0Q54_RS01830 (R0Q54_01830) comGD 308864..309295 (-) 432 WP_014480256.1 comG operon protein ComGD Machinery gene
  R0Q54_RS01835 (R0Q54_01835) comGC 309285..309581 (-) 297 WP_069964211.1 comG operon protein ComGC Machinery gene
  R0Q54_RS01840 (R0Q54_01840) comGB 309595..310632 (-) 1038 WP_031600685.1 comG operon protein ComGB Machinery gene
  R0Q54_RS01845 (R0Q54_01845) comGA 310619..311689 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  R0Q54_RS01850 (R0Q54_01850) - 311901..312098 (-) 198 WP_014480259.1 CBS domain-containing protein -
  R0Q54_RS01855 (R0Q54_01855) corA 312100..313053 (-) 954 WP_014480260.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14329.42 Da        Isoelectric Point: 5.8949

>NTDB_id=817285 R0Q54_RS01820 WP_014480254.1 308124..308507(-) (comGF) [Bacillus subtilis strain J46]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=817285 R0Q54_RS01820 WP_014480254.1 308124..308507(-) (comGF) [Bacillus subtilis strain J46]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984