Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   QBS37_RS17210 Genome accession   NZ_CP121845
Coordinates   3515891..3516361 (+) Length   156 a.a.
NCBI ID   WP_279475325.1    Uniprot ID   -
Organism   Aeromonas veronii strain ANYA 15694     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 3480954..3531449 3515891..3516361 within 0


Gene organization within MGE regions


Location: 3480954..3531449
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QBS37_RS16920 - 3480954..3481997 (-) 1044 WP_279475216.1 contractile injection system protein, VgrG/Pvc8 family -
  QBS37_RS16925 - 3481988..3482197 (-) 210 WP_267516909.1 tail protein X -
  QBS37_RS16930 - 3482197..3483105 (-) 909 WP_279475217.1 phage tail protein -
  QBS37_RS16935 - 3483102..3485192 (-) 2091 WP_279475218.1 phage tail tape measure protein -
  QBS37_RS16940 - 3485316..3485600 (-) 285 WP_279475219.1 phage tail assembly protein -
  QBS37_RS16945 - 3485652..3486158 (-) 507 WP_279475221.1 phage major tail tube protein -
  QBS37_RS16950 - 3486159..3487592 (-) 1434 WP_279475223.1 phage tail sheath C-terminal domain-containing protein -
  QBS37_RS16955 - 3487731..3488258 (-) 528 WP_279475224.1 hypothetical protein -
  QBS37_RS16960 - 3488255..3488971 (-) 717 WP_279475226.1 hypothetical protein -
  QBS37_RS16965 - 3488968..3489720 (-) 753 WP_279475227.1 phage tail protein -
  QBS37_RS16970 - 3489717..3490334 (-) 618 WP_279475229.1 phage tail protein I -
  QBS37_RS16975 - 3490327..3491226 (-) 900 WP_279475230.1 baseplate J/gp47 family protein -
  QBS37_RS16980 - 3491223..3491582 (-) 360 WP_267516823.1 GPW/gp25 family protein -
  QBS37_RS16985 - 3491612..3492112 (-) 501 WP_279475234.1 phage baseplate assembly protein V -
  QBS37_RS16990 - 3492173..3492766 (-) 594 WP_279475235.1 hypothetical protein -
  QBS37_RS16995 - 3492763..3493311 (-) 549 WP_279475237.1 phage tail protein -
  QBS37_RS17000 - 3493298..3493639 (-) 342 WP_279475239.1 hypothetical protein -
  QBS37_RS17005 - 3493639..3493995 (-) 357 WP_279475242.1 hypothetical protein -
  QBS37_RS17010 - 3493996..3494325 (-) 330 WP_279475245.1 hypothetical protein -
  QBS37_RS17015 - 3494387..3495814 (-) 1428 WP_279475247.1 phage major capsid protein -
  QBS37_RS17020 - 3496500..3498053 (-) 1554 WP_279475249.1 phage portal protein -
  QBS37_RS17025 - 3498053..3498475 (-) 423 WP_279475251.1 hypothetical protein -
  QBS37_RS17030 - 3498592..3499395 (-) 804 WP_279475254.1 terminase gpA endonuclease subunit -
  QBS37_RS17035 - 3499319..3499588 (-) 270 WP_279475255.1 terminase gpA endonuclease subunit -
  QBS37_RS17040 - 3499652..3500638 (-) 987 WP_279475258.1 phage terminase large subunit family protein -
  QBS37_RS17045 - 3500631..3500816 (-) 186 WP_279475259.1 hypothetical protein -
  QBS37_RS17050 - 3500842..3501072 (-) 231 Protein_3263 terminase small subunit -
  QBS37_RS17055 - 3501294..3501842 (-) 549 WP_279475261.1 DUF2514 domain-containing protein -
  QBS37_RS17060 - 3501845..3502342 (-) 498 WP_279475263.1 hypothetical protein -
  QBS37_RS17065 - 3502347..3502637 (-) 291 WP_279475265.1 hypothetical protein -
  QBS37_RS17070 - 3502634..3502960 (-) 327 WP_279475269.1 hypothetical protein -
  QBS37_RS17075 - 3503009..3503455 (-) 447 WP_279475271.1 hypothetical protein -
  QBS37_RS17080 - 3503452..3503838 (-) 387 WP_139734809.1 RusA family crossover junction endodeoxyribonuclease -
  QBS37_RS17085 - 3503825..3504817 (-) 993 WP_279475276.1 DUF968 domain-containing protein -
  QBS37_RS17090 - 3504814..3505014 (-) 201 WP_279475277.1 DUF3283 family protein -
  QBS37_RS17095 - 3505011..3505217 (-) 207 WP_279475278.1 hypothetical protein -
  QBS37_RS17100 - 3505214..3505570 (-) 357 WP_279475280.1 phage antirepressor KilAC domain-containing protein -
  QBS37_RS23060 - 3505713..3505919 (-) 207 Protein_3274 Rha family transcriptional regulator -
  QBS37_RS17110 - 3505916..3506389 (-) 474 WP_279475282.1 hypothetical protein -
  QBS37_RS17115 - 3506386..3506667 (-) 282 WP_279475283.1 hypothetical protein -
  QBS37_RS17120 - 3506667..3506939 (-) 273 WP_279475286.1 hypothetical protein -
  QBS37_RS17125 - 3506926..3507594 (-) 669 WP_279475288.1 replication protein P -
  QBS37_RS17130 - 3507594..3508523 (-) 930 WP_279475290.1 hypothetical protein -
  QBS37_RS17135 - 3508576..3508806 (-) 231 WP_279475292.1 hypothetical protein -
  QBS37_RS17140 - 3508884..3509405 (-) 522 WP_052497104.1 phage regulatory CII family protein -
  QBS37_RS17145 - 3509413..3509616 (-) 204 WP_279475297.1 Cro/CI family transcriptional regulator -
  QBS37_RS17150 - 3509715..3510287 (+) 573 WP_279475298.1 S24 family peptidase -
  QBS37_RS17155 - 3510418..3511356 (+) 939 WP_279475300.1 BRCT domain-containing protein -
  QBS37_RS17160 - 3511396..3511722 (+) 327 WP_279475301.1 zinc-ribbon domain-containing protein -
  QBS37_RS17165 - 3511874..3512215 (+) 342 WP_279475303.1 DUF4406 domain-containing protein -
  QBS37_RS17170 - 3512212..3512493 (+) 282 WP_279475304.1 hypothetical protein -
  QBS37_RS17175 - 3512490..3512837 (+) 348 WP_279475305.1 MT-A70 family methyltransferase -
  QBS37_RS17180 - 3512866..3513324 (+) 459 WP_279475307.1 MT-A70 family methyltransferase -
  QBS37_RS17185 - 3513321..3514007 (+) 687 WP_279475309.1 DUF927 domain-containing protein -
  QBS37_RS17190 - 3514095..3514754 (+) 660 WP_279475311.1 DUF3850 domain-containing protein -
  QBS37_RS17195 - 3514751..3515170 (+) 420 WP_279475313.1 hypothetical protein -
  QBS37_RS17200 - 3515386..3515625 (+) 240 WP_159158917.1 hypothetical protein -
  QBS37_RS17205 - 3515640..3515894 (+) 255 WP_279475321.1 hypothetical protein -
  QBS37_RS17210 ssb 3515891..3516361 (+) 471 WP_279475325.1 single-stranded DNA-binding protein Machinery gene
  QBS37_RS17215 - 3516638..3516883 (+) 246 WP_043851906.1 hypothetical protein -
  QBS37_RS17220 - 3516902..3517159 (+) 258 WP_279475329.1 hypothetical protein -
  QBS37_RS17225 - 3517167..3518369 (-) 1203 WP_279475330.1 site-specific integrase -
  QBS37_RS17230 - 3518756..3519344 (-) 589 Protein_3299 tetratricopeptide repeat protein -
  QBS37_RS17235 - 3519518..3520573 (+) 1056 WP_257725079.1 PA0069 family radical SAM protein -
  QBS37_RS17240 - 3520744..3520899 (-) 156 WP_005336695.1 hypothetical protein -
  QBS37_RS17245 - 3521162..3522559 (+) 1398 WP_162516076.1 alpha-amylase family protein -
  QBS37_RS17250 gyrA 3522667..3525414 (-) 2748 WP_005352118.1 DNA topoisomerase (ATP-hydrolyzing) subunit A -
  QBS37_RS17255 ubiG 3525613..3526329 (+) 717 WP_005352120.1 bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG -
  QBS37_RS17260 - 3526329..3527024 (+) 696 WP_139441689.1 HAD-IA family hydrolase -
  QBS37_RS17265 nrdA 3527648..3529915 (+) 2268 WP_019838757.1 class 1a ribonucleoside-diphosphate reductase subunit alpha -
  QBS37_RS17270 nrdB 3529996..3531129 (+) 1134 WP_159143713.1 class Ia ribonucleoside-diphosphate reductase subunit beta -
  QBS37_RS17275 yfaE 3531126..3531449 (+) 324 WP_021230069.1 class I ribonucleotide reductase maintenance protein YfaE -

Sequence

Protein


Download         Length: 156 a.a.        Molecular weight: 17390.42 Da        Isoelectric Point: 7.2020

>NTDB_id=814672 QBS37_RS17210 WP_279475325.1 3515891..3516361(+) (ssb) [Aeromonas veronii strain ANYA 15694]
MKRGINKVILIGNLGQDPEVRYNQGGGSVTSITLATSESWRDKQTGEQKERTEWHRVVFMGKLAEVAGQHLKKGTQVYVE
GKLQTRKWQAQEGSDRYTTEVMVDSFTGVLQMLGSRPQQSQPPASQPQGGYGRPAQQPAPPAYNEPPIDFDDDIQF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=814672 QBS37_RS17210 WP_279475325.1 3515891..3516361(+) (ssb) [Aeromonas veronii strain ANYA 15694]
ATGAAACGAGGCATAAACAAGGTCATCCTGATCGGCAATCTTGGGCAGGATCCGGAAGTGCGCTACAACCAGGGCGGCGG
GTCCGTTACCTCAATCACCCTTGCCACCTCCGAATCATGGCGCGACAAGCAGACCGGTGAGCAGAAAGAGCGCACCGAGT
GGCACCGTGTGGTGTTCATGGGTAAGCTGGCCGAGGTAGCAGGCCAGCACCTCAAGAAGGGAACGCAGGTCTACGTCGAA
GGCAAGCTGCAGACCCGCAAATGGCAGGCGCAGGAAGGCAGCGACCGCTACACCACAGAGGTGATGGTCGATAGCTTCAC
CGGCGTACTGCAGATGCTGGGCAGCAGACCACAGCAAAGCCAGCCACCAGCATCACAGCCACAGGGCGGATATGGCCGCC
CAGCTCAGCAACCGGCACCGCCCGCTTACAACGAGCCGCCTATTGATTTTGACGACGATATCCAGTTCTGA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(5-106)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

61.494

100

0.686
  ssb Glaesserella parasuis strain SC1401

50.543

100

0.596
  ssb Neisseria gonorrhoeae MS11

42.938

100

0.487
  ssb Neisseria meningitidis MC58

41.808

100

0.474