Detailed information
Overview
| Name | pilL | Type | Machinery gene |
| Locus tag | HT085_RS02710 | Genome accession | NZ_AP023069 |
| Coordinates | 519988..520461 (+) | Length | 157 a.a. |
| NCBI ID | WP_025455782.1 | Uniprot ID | - |
| Organism | Neisseria gonorrhoeae strain TUM19854 | ||
| Function | type IV pilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 515442..571515 | 519988..520461 | within | 0 |
Gene organization within MGE regions
Location: 515442..571515
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HT085_RS02685 (TUM19854C_05010) | dnaB | 515442..516848 (+) | 1407 | WP_003690896.1 | replicative DNA helicase | - |
| HT085_RS02690 (TUM19854C_05020) | pilH | 517156..517821 (+) | 666 | WP_003690897.1 | Tfp pilus assembly protein FimT/FimU | Machinery gene |
| HT085_RS02695 (TUM19854C_05030) | pilI | 517853..518461 (+) | 609 | WP_003690898.1 | type IV pilus modification protein PilV | Machinery gene |
| HT085_RS02700 (TUM19854C_05040) | pilJ | 518458..519399 (+) | 942 | WP_003690899.1 | PilW family protein | Machinery gene |
| HT085_RS02705 (TUM19854C_05050) | pilK | 519378..519986 (+) | 609 | WP_003690900.1 | pilus assembly protein | Machinery gene |
| HT085_RS02710 (TUM19854C_05060) | pilL | 519988..520461 (+) | 474 | WP_025455782.1 | PilX family type IV pilin | Machinery gene |
| HT085_RS02715 (TUM19854C_05070) | - | 521073..521518 (-) | 446 | Protein_523 | AzlC family ABC transporter permease | - |
| HT085_RS02720 (TUM19854C_05080) | dut | 521684..522136 (+) | 453 | WP_003690909.1 | dUTP diphosphatase | - |
| HT085_RS02725 (TUM19854C_05090) | dapC | 522214..523401 (+) | 1188 | WP_003690911.1 | succinyldiaminopimelate transaminase | - |
| HT085_RS02730 (TUM19854C_05110) | yaaA | 523557..524336 (+) | 780 | WP_003690913.1 | peroxide stress protein YaaA | - |
| HT085_RS02745 (TUM19854C_05120) | - | 524867..526063 (+) | 1197 | WP_003704323.1 | integrase arm-type DNA-binding domain-containing protein | - |
| HT085_RS02750 (TUM19854C_05130) | - | 526419..526688 (-) | 270 | WP_003687928.1 | hypothetical protein | - |
| HT085_RS02755 (TUM19854C_05150) | - | 526883..527566 (-) | 684 | WP_003687929.1 | DUF2786 domain-containing protein | - |
| HT085_RS12125 | - | 527880..528113 (-) | 234 | Protein_530 | hypothetical protein | - |
| HT085_RS02765 (TUM19854C_05170) | - | 528224..528439 (-) | 216 | WP_003691538.1 | hypothetical protein | - |
| HT085_RS02770 (TUM19854C_05180) | - | 528491..528982 (-) | 492 | WP_003691537.1 | siphovirus Gp157 family protein | - |
| HT085_RS02775 (TUM19854C_05190) | - | 528979..529161 (-) | 183 | WP_003691535.1 | hypothetical protein | - |
| HT085_RS02780 (TUM19854C_05200) | - | 529301..529987 (-) | 687 | WP_003691532.1 | hypothetical protein | - |
| HT085_RS02785 (TUM19854C_05210) | - | 530056..530217 (-) | 162 | WP_003691530.1 | hypothetical protein | - |
| HT085_RS02790 (TUM19854C_05220) | - | 530214..530492 (-) | 279 | WP_003691529.1 | hypothetical protein | - |
| HT085_RS02795 (TUM19854C_05230) | - | 530645..530977 (-) | 333 | WP_003691528.1 | hypothetical protein | - |
| HT085_RS02800 (TUM19854C_05240) | - | 531118..531393 (-) | 276 | WP_003691527.1 | hypothetical protein | - |
| HT085_RS02805 (TUM19854C_05250) | - | 531390..531866 (-) | 477 | WP_003691526.1 | hypothetical protein | - |
| HT085_RS02810 (TUM19854C_05260) | - | 531899..532099 (-) | 201 | WP_003692842.1 | hypothetical protein | - |
| HT085_RS02815 (TUM19854C_05270) | - | 532297..532710 (-) | 414 | WP_003687963.1 | hypothetical protein | - |
| HT085_RS02820 (TUM19854C_05280) | - | 532707..533168 (-) | 462 | WP_003687965.1 | helix-turn-helix transcriptional regulator | - |
| HT085_RS02825 (TUM19854C_05290) | - | 533185..533622 (-) | 438 | WP_003687967.1 | hypothetical protein | - |
| HT085_RS02830 (TUM19854C_05300) | - | 533737..534453 (-) | 717 | WP_003687969.1 | LexA family transcriptional regulator | - |
| HT085_RS02835 (TUM19854C_05310) | - | 534522..534758 (+) | 237 | WP_003687971.1 | Cro/CI family transcriptional regulator | - |
| HT085_RS02840 (TUM19854C_05320) | - | 534838..534993 (+) | 156 | WP_047923772.1 | hypothetical protein | - |
| HT085_RS02845 (TUM19854C_05330) | - | 534970..535158 (-) | 189 | WP_050157615.1 | hypothetical protein | - |
| HT085_RS02850 (TUM19854C_05340) | - | 535332..535559 (+) | 228 | WP_003691442.1 | helix-turn-helix domain-containing protein | - |
| HT085_RS02855 (TUM19854C_05350) | - | 535556..536566 (+) | 1011 | WP_014580341.1 | helix-turn-helix domain-containing protein | - |
| HT085_RS02860 (TUM19854C_05360) | - | 536578..537357 (+) | 780 | WP_025455804.1 | ATP-binding protein | - |
| HT085_RS02865 (TUM19854C_05370) | - | 537370..537636 (+) | 267 | WP_172763933.1 | hypothetical protein | - |
| HT085_RS02870 (TUM19854C_05380) | - | 537675..538169 (+) | 495 | WP_003691434.1 | DUF3310 domain-containing protein | - |
| HT085_RS02875 (TUM19854C_05390) | - | 538346..538495 (+) | 150 | WP_003689110.1 | hypothetical protein | - |
| HT085_RS11675 (TUM19854C_05400) | - | 538524..538805 (+) | 282 | WP_003689109.1 | hypothetical protein | - |
| HT085_RS02880 (TUM19854C_05410) | - | 538796..539176 (+) | 381 | WP_017147222.1 | RusA family crossover junction endodeoxyribonuclease | - |
| HT085_RS02885 (TUM19854C_05420) | - | 539443..539850 (+) | 408 | WP_003691430.1 | hypothetical protein | - |
| HT085_RS02890 (TUM19854C_05430) | - | 539941..541101 (+) | 1161 | WP_003691428.1 | type I restriction endonuclease | - |
| HT085_RS02895 (TUM19854C_05440) | - | 541385..542254 (+) | 870 | WP_106158880.1 | Bro-N domain-containing protein | - |
| HT085_RS02900 (TUM19854C_05450) | - | 542547..542996 (+) | 450 | WP_003695485.1 | hypothetical protein | - |
| HT085_RS02905 (TUM19854C_05460) | terL | 543058..544479 (+) | 1422 | WP_003697216.1 | phage terminase large subunit | - |
| HT085_RS02910 (TUM19854C_05470) | - | 544476..546623 (+) | 2148 | WP_003691423.1 | phage portal protein | - |
| HT085_RS02915 (TUM19854C_05480) | - | 546691..547848 (+) | 1158 | WP_010360058.1 | HK97 family phage prohead protease | - |
| HT085_RS02920 (TUM19854C_05490) | - | 547889..549388 (+) | 1500 | WP_003689084.1 | hypothetical protein | - |
| HT085_RS02925 (TUM19854C_05500) | - | 549395..549757 (+) | 363 | WP_003689082.1 | hypothetical protein | - |
| HT085_RS02930 (TUM19854C_05510) | - | 549760..550290 (+) | 531 | WP_003689080.1 | head-tail connector protein | - |
| HT085_RS02935 (TUM19854C_05520) | - | 550290..550772 (+) | 483 | WP_010360061.1 | HK97 gp10 family phage protein | - |
| HT085_RS02940 (TUM19854C_05530) | - | 550769..551197 (+) | 429 | WP_003689076.1 | hypothetical protein | - |
| HT085_RS02945 (TUM19854C_05540) | - | 551223..551996 (+) | 774 | WP_003692869.1 | hypothetical protein | - |
| HT085_RS02950 (TUM19854C_05550) | - | 552057..552386 (+) | 330 | WP_003689072.1 | hypothetical protein | - |
| HT085_RS02955 (TUM19854C_05560) | - | 552398..552664 (+) | 267 | WP_003689070.1 | hypothetical protein | - |
| HT085_RS02960 (TUM19854C_05570) | - | 552664..553263 (+) | 600 | WP_003691415.1 | DUF2460 domain-containing protein | - |
| HT085_RS02965 (TUM19854C_05580) | - | 553260..554114 (+) | 855 | WP_003698614.1 | DUF2163 domain-containing protein | - |
| HT085_RS02970 (TUM19854C_05590) | - | 554116..554547 (+) | 432 | WP_003689064.1 | NlpC/P60 family protein | - |
| HT085_RS02975 (TUM19854C_05600) | - | 554575..554853 (-) | 279 | WP_003689062.1 | XRE family transcriptional regulator | - |
| HT085_RS02980 (TUM19854C_05610) | - | 555093..559238 (+) | 4146 | WP_172763934.1 | phage tail protein | - |
| HT085_RS02985 (TUM19854C_05620) | - | 559350..559655 (+) | 306 | WP_003689058.1 | hypothetical protein | - |
| HT085_RS02990 (TUM19854C_05630) | - | 559726..560196 (+) | 471 | WP_003691410.1 | hypothetical protein | - |
| HT085_RS02995 (TUM19854C_05640) | - | 560197..560529 (+) | 333 | WP_003691408.1 | hypothetical protein | - |
| HT085_RS03000 (TUM19854C_05650) | - | 560897..561244 (-) | 348 | WP_003689051.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| HT085_RS03005 (TUM19854C_05660) | - | 561244..561480 (-) | 237 | WP_003689049.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
| HT085_RS12015 | - | 561520..561645 (+) | 126 | WP_255294325.1 | hypothetical protein | - |
| HT085_RS03010 (TUM19854C_05670) | - | 561687..562226 (+) | 540 | WP_050163081.1 | TIGR02594 family protein | - |
| HT085_RS03015 (TUM19854C_05680) | - | 562227..562571 (+) | 345 | WP_003695464.1 | hypothetical protein | - |
| HT085_RS03020 (TUM19854C_05690) | - | 562555..562728 (+) | 174 | WP_017146757.1 | hypothetical protein | - |
| HT085_RS03025 | - | 563040..563189 (+) | 150 | WP_003691402.1 | hypothetical protein | - |
| HT085_RS03030 (TUM19854C_05700) | - | 563219..566266 (+) | 3048 | WP_172763935.1 | tape measure protein | - |
| HT085_RS03035 (TUM19854C_05710) | - | 566326..566805 (-) | 480 | WP_002241413.1 | DUF4760 domain-containing protein | - |
| HT085_RS03040 | - | 567147..568136 (-) | 990 | WP_003689040.1 | site-specific integrase | - |
| HT085_RS03045 (TUM19854C_05730) | - | 568396..568584 (-) | 189 | WP_003689039.1 | hypothetical protein | - |
| HT085_RS03050 (TUM19854C_05740) | purM | 568825..569859 (+) | 1035 | WP_003691398.1 | phosphoribosylformylglycinamidine cyclo-ligase | - |
| HT085_RS03060 (TUM19854C_05760) | - | 570862..571515 (+) | 654 | WP_017147274.1 | IS1595 family transposase | - |
Sequence
Protein
Download Length: 157 a.a. Molecular weight: 17506.38 Da Isoelectric Point: 9.8238
>NTDB_id=80979 HT085_RS02710 WP_025455782.1 519988..520461(+) (pilL) [Neisseria gonorrhoeae strain TUM19854]
MEQKGFTLIEMMIVVTILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNVLKQFILKNPQDNNQTIKSKLEIFVSGYKM
NPKIAKKYSVSVKFVDAEKPRVYRLVGVPNVGTGYTLSVWMNSVGDGYKCRDAASAKAYKEQLSGDGGCEALSNRKK
MEQKGFTLIEMMIVVTILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNVLKQFILKNPQDNNQTIKSKLEIFVSGYKM
NPKIAKKYSVSVKFVDAEKPRVYRLVGVPNVGTGYTLSVWMNSVGDGYKCRDAASAKAYKEQLSGDGGCEALSNRKK
Nucleotide
Download Length: 474 bp
>NTDB_id=80979 HT085_RS02710 WP_025455782.1 519988..520461(+) (pilL) [Neisseria gonorrhoeae strain TUM19854]
ATGGAACAAAAAGGGTTTACATTGATTGAGATGATGATAGTTGTCACGATACTCGGCATCATCAGCGTCATTGCCATACC
TTCTTATCAGAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATGTTCTCAAAC
AGTTTATTTTGAAAAATCCCCAGGACAATAATCAGACCATCAAGAGCAAACTGGAAATATTTGTCTCAGGCTATAAGATG
AATCCGAAAATTGCCAAAAAATATAGTGTTTCGGTAAAGTTTGTCGATGCGGAAAAACCAAGGGTATACAGGTTGGTCGG
TGTTCCGAACGTGGGGACGGGTTATACCTTGTCGGTATGGATGAACAGCGTGGGCGACGGATACAAATGCCGTGATGCCG
CTTCGGCAAAGGCCTATAAAGAGCAGTTGTCCGGAGACGGTGGTTGTGAAGCCTTATCCAACCGTAAGAAATAG
ATGGAACAAAAAGGGTTTACATTGATTGAGATGATGATAGTTGTCACGATACTCGGCATCATCAGCGTCATTGCCATACC
TTCTTATCAGAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATGTTCTCAAAC
AGTTTATTTTGAAAAATCCCCAGGACAATAATCAGACCATCAAGAGCAAACTGGAAATATTTGTCTCAGGCTATAAGATG
AATCCGAAAATTGCCAAAAAATATAGTGTTTCGGTAAAGTTTGTCGATGCGGAAAAACCAAGGGTATACAGGTTGGTCGG
TGTTCCGAACGTGGGGACGGGTTATACCTTGTCGGTATGGATGAACAGCGTGGGCGACGGATACAAATGCCGTGATGCCG
CTTCGGCAAAGGCCTATAAAGAGCAGTTGTCCGGAGACGGTGGTTGTGAAGCCTTATCCAACCGTAAGAAATAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilL | Neisseria gonorrhoeae MS11 |
89.172 |
100 |
0.892 |
| pilX | Neisseria meningitidis 8013 |
85.987 |
100 |
0.86 |