Detailed information    

insolico Bioinformatically predicted

Overview


Name   pilK   Type   Machinery gene
Locus tag   HT085_RS02705 Genome accession   NZ_AP023069
Coordinates   519378..519986 (+) Length   202 a.a.
NCBI ID   WP_003690900.1    Uniprot ID   A0AB74EBN2
Organism   Neisseria gonorrhoeae strain TUM19854     
Function   type IV pilus (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 515442..571515 519378..519986 within 0


Gene organization within MGE regions


Location: 515442..571515
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HT085_RS02685 (TUM19854C_05010) dnaB 515442..516848 (+) 1407 WP_003690896.1 replicative DNA helicase -
  HT085_RS02690 (TUM19854C_05020) pilH 517156..517821 (+) 666 WP_003690897.1 Tfp pilus assembly protein FimT/FimU Machinery gene
  HT085_RS02695 (TUM19854C_05030) pilI 517853..518461 (+) 609 WP_003690898.1 type IV pilus modification protein PilV Machinery gene
  HT085_RS02700 (TUM19854C_05040) pilJ 518458..519399 (+) 942 WP_003690899.1 PilW family protein Machinery gene
  HT085_RS02705 (TUM19854C_05050) pilK 519378..519986 (+) 609 WP_003690900.1 pilus assembly protein Machinery gene
  HT085_RS02710 (TUM19854C_05060) pilL 519988..520461 (+) 474 WP_025455782.1 PilX family type IV pilin Machinery gene
  HT085_RS02715 (TUM19854C_05070) - 521073..521518 (-) 446 Protein_523 AzlC family ABC transporter permease -
  HT085_RS02720 (TUM19854C_05080) dut 521684..522136 (+) 453 WP_003690909.1 dUTP diphosphatase -
  HT085_RS02725 (TUM19854C_05090) dapC 522214..523401 (+) 1188 WP_003690911.1 succinyldiaminopimelate transaminase -
  HT085_RS02730 (TUM19854C_05110) yaaA 523557..524336 (+) 780 WP_003690913.1 peroxide stress protein YaaA -
  HT085_RS02745 (TUM19854C_05120) - 524867..526063 (+) 1197 WP_003704323.1 integrase arm-type DNA-binding domain-containing protein -
  HT085_RS02750 (TUM19854C_05130) - 526419..526688 (-) 270 WP_003687928.1 hypothetical protein -
  HT085_RS02755 (TUM19854C_05150) - 526883..527566 (-) 684 WP_003687929.1 DUF2786 domain-containing protein -
  HT085_RS12125 - 527880..528113 (-) 234 Protein_530 hypothetical protein -
  HT085_RS02765 (TUM19854C_05170) - 528224..528439 (-) 216 WP_003691538.1 hypothetical protein -
  HT085_RS02770 (TUM19854C_05180) - 528491..528982 (-) 492 WP_003691537.1 siphovirus Gp157 family protein -
  HT085_RS02775 (TUM19854C_05190) - 528979..529161 (-) 183 WP_003691535.1 hypothetical protein -
  HT085_RS02780 (TUM19854C_05200) - 529301..529987 (-) 687 WP_003691532.1 hypothetical protein -
  HT085_RS02785 (TUM19854C_05210) - 530056..530217 (-) 162 WP_003691530.1 hypothetical protein -
  HT085_RS02790 (TUM19854C_05220) - 530214..530492 (-) 279 WP_003691529.1 hypothetical protein -
  HT085_RS02795 (TUM19854C_05230) - 530645..530977 (-) 333 WP_003691528.1 hypothetical protein -
  HT085_RS02800 (TUM19854C_05240) - 531118..531393 (-) 276 WP_003691527.1 hypothetical protein -
  HT085_RS02805 (TUM19854C_05250) - 531390..531866 (-) 477 WP_003691526.1 hypothetical protein -
  HT085_RS02810 (TUM19854C_05260) - 531899..532099 (-) 201 WP_003692842.1 hypothetical protein -
  HT085_RS02815 (TUM19854C_05270) - 532297..532710 (-) 414 WP_003687963.1 hypothetical protein -
  HT085_RS02820 (TUM19854C_05280) - 532707..533168 (-) 462 WP_003687965.1 helix-turn-helix transcriptional regulator -
  HT085_RS02825 (TUM19854C_05290) - 533185..533622 (-) 438 WP_003687967.1 hypothetical protein -
  HT085_RS02830 (TUM19854C_05300) - 533737..534453 (-) 717 WP_003687969.1 LexA family transcriptional regulator -
  HT085_RS02835 (TUM19854C_05310) - 534522..534758 (+) 237 WP_003687971.1 Cro/CI family transcriptional regulator -
  HT085_RS02840 (TUM19854C_05320) - 534838..534993 (+) 156 WP_047923772.1 hypothetical protein -
  HT085_RS02845 (TUM19854C_05330) - 534970..535158 (-) 189 WP_050157615.1 hypothetical protein -
  HT085_RS02850 (TUM19854C_05340) - 535332..535559 (+) 228 WP_003691442.1 helix-turn-helix domain-containing protein -
  HT085_RS02855 (TUM19854C_05350) - 535556..536566 (+) 1011 WP_014580341.1 helix-turn-helix domain-containing protein -
  HT085_RS02860 (TUM19854C_05360) - 536578..537357 (+) 780 WP_025455804.1 ATP-binding protein -
  HT085_RS02865 (TUM19854C_05370) - 537370..537636 (+) 267 WP_172763933.1 hypothetical protein -
  HT085_RS02870 (TUM19854C_05380) - 537675..538169 (+) 495 WP_003691434.1 DUF3310 domain-containing protein -
  HT085_RS02875 (TUM19854C_05390) - 538346..538495 (+) 150 WP_003689110.1 hypothetical protein -
  HT085_RS11675 (TUM19854C_05400) - 538524..538805 (+) 282 WP_003689109.1 hypothetical protein -
  HT085_RS02880 (TUM19854C_05410) - 538796..539176 (+) 381 WP_017147222.1 RusA family crossover junction endodeoxyribonuclease -
  HT085_RS02885 (TUM19854C_05420) - 539443..539850 (+) 408 WP_003691430.1 hypothetical protein -
  HT085_RS02890 (TUM19854C_05430) - 539941..541101 (+) 1161 WP_003691428.1 type I restriction endonuclease -
  HT085_RS02895 (TUM19854C_05440) - 541385..542254 (+) 870 WP_106158880.1 Bro-N domain-containing protein -
  HT085_RS02900 (TUM19854C_05450) - 542547..542996 (+) 450 WP_003695485.1 hypothetical protein -
  HT085_RS02905 (TUM19854C_05460) terL 543058..544479 (+) 1422 WP_003697216.1 phage terminase large subunit -
  HT085_RS02910 (TUM19854C_05470) - 544476..546623 (+) 2148 WP_003691423.1 phage portal protein -
  HT085_RS02915 (TUM19854C_05480) - 546691..547848 (+) 1158 WP_010360058.1 HK97 family phage prohead protease -
  HT085_RS02920 (TUM19854C_05490) - 547889..549388 (+) 1500 WP_003689084.1 hypothetical protein -
  HT085_RS02925 (TUM19854C_05500) - 549395..549757 (+) 363 WP_003689082.1 hypothetical protein -
  HT085_RS02930 (TUM19854C_05510) - 549760..550290 (+) 531 WP_003689080.1 head-tail connector protein -
  HT085_RS02935 (TUM19854C_05520) - 550290..550772 (+) 483 WP_010360061.1 HK97 gp10 family phage protein -
  HT085_RS02940 (TUM19854C_05530) - 550769..551197 (+) 429 WP_003689076.1 hypothetical protein -
  HT085_RS02945 (TUM19854C_05540) - 551223..551996 (+) 774 WP_003692869.1 hypothetical protein -
  HT085_RS02950 (TUM19854C_05550) - 552057..552386 (+) 330 WP_003689072.1 hypothetical protein -
  HT085_RS02955 (TUM19854C_05560) - 552398..552664 (+) 267 WP_003689070.1 hypothetical protein -
  HT085_RS02960 (TUM19854C_05570) - 552664..553263 (+) 600 WP_003691415.1 DUF2460 domain-containing protein -
  HT085_RS02965 (TUM19854C_05580) - 553260..554114 (+) 855 WP_003698614.1 DUF2163 domain-containing protein -
  HT085_RS02970 (TUM19854C_05590) - 554116..554547 (+) 432 WP_003689064.1 NlpC/P60 family protein -
  HT085_RS02975 (TUM19854C_05600) - 554575..554853 (-) 279 WP_003689062.1 XRE family transcriptional regulator -
  HT085_RS02980 (TUM19854C_05610) - 555093..559238 (+) 4146 WP_172763934.1 phage tail protein -
  HT085_RS02985 (TUM19854C_05620) - 559350..559655 (+) 306 WP_003689058.1 hypothetical protein -
  HT085_RS02990 (TUM19854C_05630) - 559726..560196 (+) 471 WP_003691410.1 hypothetical protein -
  HT085_RS02995 (TUM19854C_05640) - 560197..560529 (+) 333 WP_003691408.1 hypothetical protein -
  HT085_RS03000 (TUM19854C_05650) - 560897..561244 (-) 348 WP_003689051.1 type II toxin-antitoxin system PemK/MazF family toxin -
  HT085_RS03005 (TUM19854C_05660) - 561244..561480 (-) 237 WP_003689049.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
  HT085_RS12015 - 561520..561645 (+) 126 WP_255294325.1 hypothetical protein -
  HT085_RS03010 (TUM19854C_05670) - 561687..562226 (+) 540 WP_050163081.1 TIGR02594 family protein -
  HT085_RS03015 (TUM19854C_05680) - 562227..562571 (+) 345 WP_003695464.1 hypothetical protein -
  HT085_RS03020 (TUM19854C_05690) - 562555..562728 (+) 174 WP_017146757.1 hypothetical protein -
  HT085_RS03025 - 563040..563189 (+) 150 WP_003691402.1 hypothetical protein -
  HT085_RS03030 (TUM19854C_05700) - 563219..566266 (+) 3048 WP_172763935.1 tape measure protein -
  HT085_RS03035 (TUM19854C_05710) - 566326..566805 (-) 480 WP_002241413.1 DUF4760 domain-containing protein -
  HT085_RS03040 - 567147..568136 (-) 990 WP_003689040.1 site-specific integrase -
  HT085_RS03045 (TUM19854C_05730) - 568396..568584 (-) 189 WP_003689039.1 hypothetical protein -
  HT085_RS03050 (TUM19854C_05740) purM 568825..569859 (+) 1035 WP_003691398.1 phosphoribosylformylglycinamidine cyclo-ligase -
  HT085_RS03060 (TUM19854C_05760) - 570862..571515 (+) 654 WP_017147274.1 IS1595 family transposase -

Sequence


Protein


Download         Length: 202 a.a.        Molecular weight: 22023.05 Da        Isoelectric Point: 7.5810

>NTDB_id=80978 HT085_RS02705 WP_003690900.1 519378..519986(+) (pilK) [Neisseria gonorrhoeae strain TUM19854]
MRKQNALTGIPTSEGQRGFALFIVLMVMIVVAFLVVTAAQSYNTEQRISANESDRKLALSLAEAALREGEFQVLDLEYTA
DSKVTFSENCENGLCTAVNVRTNDANEETFDNIVVKGKPTVEAVKRPCPAKSGKNSAGLCIDNKGMEYNKGVAGVSKMPR
YIIEYLGVKNGQNVYRVTAKAWGKNANTVVVLQSYVGNNDEQ

Nucleotide


Download         Length: 609 bp        

>NTDB_id=80978 HT085_RS02705 WP_003690900.1 519378..519986(+) (pilK) [Neisseria gonorrhoeae strain TUM19854]
ATGCGCAAACAGAACGCTTTGACAGGAATCCCGACTTCTGAGGGACAGAGGGGGTTCGCACTGTTTATCGTGCTGATGGT
GATGATAGTCGTGGCCTTTTTGGTTGTAACTGCCGCCCAGTCCTACAATACCGAACAGAGGATCAGTGCCAACGAATCAG
ACAGGAAATTGGCTTTGTCTTTAGCCGAGGCGGCTTTGAGGGAAGGCGAATTTCAGGTTTTGGATTTGGAATATACTGCG
GATAGTAAGGTTACATTTAGCGAAAACTGTGAAAACGGCCTGTGTACCGCAGTGAATGTACGGACAAATGATGCTAATGA
AGAGACTTTTGACAATATCGTGGTGAAAGGCAAGCCTACCGTTGAGGCCGTGAAGCGTCCTTGCCCTGCAAAGTCTGGCA
AAAATTCTGCCGGTCTGTGCATTGACAATAAAGGGATGGAATATAATAAAGGCGTGGCAGGCGTCAGCAAAATGCCGCGC
TATATTATCGAATATTTAGGCGTGAAGAACGGACAAAATGTTTATCGGGTTACTGCCAAGGCTTGGGGTAAGAATGCCAA
TACCGTGGTCGTCCTTCAATCTTATGTAGGCAATAATGATGAGCAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilK Neisseria gonorrhoeae MS11

89.163

100

0.896


Multiple sequence alignment