Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   P3X84_RS11490 Genome accession   NZ_CP120969
Coordinates   2484190..2484690 (-) Length   166 a.a.
NCBI ID   WP_277836281.1    Uniprot ID   -
Organism   Pseudomonas putida strain AHSWHJXPP1     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2471886..2519452 2484190..2484690 within 0


Gene organization within MGE regions


Location: 2471886..2519452
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  P3X84_RS11390 (P3X84_11390) - 2471886..2472953 (-) 1068 WP_060538831.1 phosphotransferase family protein -
  P3X84_RS11395 (P3X84_11395) - 2473137..2473454 (-) 318 WP_003251077.1 SCP2 sterol-binding domain-containing protein -
  P3X84_RS11400 (P3X84_11400) - 2473511..2474221 (-) 711 WP_004577259.1 histidine phosphatase family protein -
  P3X84_RS11405 (P3X84_11405) sohB 2474419..2475438 (+) 1020 WP_019750964.1 protease SohB -
  P3X84_RS11415 (P3X84_11415) - 2475765..2476817 (-) 1053 WP_013973206.1 tyrosine-type recombinase/integrase -
  P3X84_RS11420 (P3X84_11420) - 2476819..2477064 (-) 246 WP_277836270.1 DUF4224 domain-containing protein -
  P3X84_RS11425 (P3X84_11425) - 2477104..2477583 (-) 480 WP_277836271.1 hypothetical protein -
  P3X84_RS11430 (P3X84_11430) - 2477637..2478560 (-) 924 WP_277836272.1 DHHA1 domain-containing protein -
  P3X84_RS11435 (P3X84_11435) - 2478849..2479241 (-) 393 WP_277836273.1 phage protein NinX family protein -
  P3X84_RS11440 (P3X84_11440) - 2479238..2479594 (-) 357 WP_277836274.1 hypothetical protein -
  P3X84_RS11445 (P3X84_11445) - 2479591..2479842 (-) 252 WP_024086938.1 hypothetical protein -
  P3X84_RS11450 (P3X84_11450) - 2479839..2480489 (-) 651 WP_277836275.1 hypothetical protein -
  P3X84_RS11455 (P3X84_11455) - 2480573..2480761 (-) 189 WP_043206566.1 hypothetical protein -
  P3X84_RS11460 (P3X84_11460) - 2480758..2481243 (-) 486 WP_277836276.1 hypothetical protein -
  P3X84_RS11465 (P3X84_11465) - 2481303..2481884 (+) 582 WP_277836277.1 hypothetical protein -
  P3X84_RS11470 (P3X84_11470) - 2481976..2482593 (-) 618 WP_277836278.1 hypothetical protein -
  P3X84_RS11475 (P3X84_11475) yejK 2482608..2483618 (-) 1011 WP_277836279.1 nucleoid-associated protein YejK -
  P3X84_RS11480 (P3X84_11480) - 2483696..2483944 (-) 249 WP_277836280.1 hypothetical protein -
  P3X84_RS11485 (P3X84_11485) - 2484026..2484187 (-) 162 WP_196183092.1 hypothetical protein -
  P3X84_RS11490 (P3X84_11490) ssb 2484190..2484690 (-) 501 WP_277836281.1 single-stranded DNA-binding protein Machinery gene
  P3X84_RS11495 (P3X84_11495) - 2484687..2485019 (-) 333 WP_277836282.1 hypothetical protein -
  P3X84_RS11500 (P3X84_11500) - 2485037..2485420 (-) 384 WP_277836283.1 helix-turn-helix transcriptional regulator -
  P3X84_RS11505 (P3X84_11505) - 2485780..2486070 (-) 291 WP_277836284.1 hypothetical protein -
  P3X84_RS11510 (P3X84_11510) - 2486406..2486807 (-) 402 WP_277836285.1 hypothetical protein -
  P3X84_RS11515 (P3X84_11515) - 2486861..2487607 (-) 747 WP_277836286.1 S24 family peptidase -
  P3X84_RS11520 (P3X84_11520) - 2487646..2487885 (+) 240 WP_277836287.1 hypothetical protein -
  P3X84_RS11525 (P3X84_11525) - 2488017..2488874 (+) 858 WP_277836288.1 replication protein -
  P3X84_RS11530 (P3X84_11530) - 2488864..2489673 (+) 810 WP_277836289.1 ATP-binding protein -
  P3X84_RS11535 (P3X84_11535) - 2489676..2489972 (+) 297 WP_277836290.1 DUF1364 domain-containing protein -
  P3X84_RS11540 (P3X84_11540) - 2489969..2490397 (+) 429 WP_277836291.1 VRR-NUC domain-containing protein -
  P3X84_RS11545 (P3X84_11545) - 2490394..2491692 (+) 1299 WP_277836292.1 site-specific integrase -
  P3X84_RS11550 (P3X84_11550) - 2491689..2491979 (+) 291 WP_277836293.1 hypothetical protein -
  P3X84_RS11555 (P3X84_11555) - 2491976..2492293 (+) 318 WP_277836294.1 hypothetical protein -
  P3X84_RS11560 (P3X84_11560) - 2492304..2492990 (+) 687 WP_108191427.1 hypothetical protein -
  P3X84_RS11565 (P3X84_11565) - 2493150..2493524 (+) 375 WP_085273440.1 putative holin -
  P3X84_RS11570 (P3X84_11570) - 2493525..2493806 (+) 282 WP_277836295.1 phage holin family protein -
  P3X84_RS11575 (P3X84_11575) - 2493806..2494024 (+) 219 WP_277836296.1 hypothetical protein -
  P3X84_RS11580 (P3X84_11580) - 2494293..2494472 (+) 180 WP_277836297.1 hypothetical protein -
  P3X84_RS11585 (P3X84_11585) - 2494568..2494849 (+) 282 WP_347276622.1 HNH endonuclease signature motif containing protein -
  P3X84_RS11590 (P3X84_11590) - 2495102..2495587 (+) 486 WP_277836299.1 phage terminase small subunit P27 family -
  P3X84_RS11595 (P3X84_11595) - 2495588..2497312 (+) 1725 WP_277836300.1 terminase large subunit -
  P3X84_RS11600 (P3X84_11600) - 2497312..2498712 (+) 1401 WP_277836301.1 phage portal protein -
  P3X84_RS11605 (P3X84_11605) - 2498727..2499614 (+) 888 WP_277836302.1 head maturation protease, ClpP-related -
  P3X84_RS11610 (P3X84_11610) - 2499611..2500825 (+) 1215 WP_277836303.1 phage major capsid protein -
  P3X84_RS11615 (P3X84_11615) - 2500867..2501112 (+) 246 WP_277836304.1 hypothetical protein -
  P3X84_RS11620 (P3X84_11620) - 2501115..2501591 (+) 477 WP_277836305.1 head-tail connector protein -
  P3X84_RS11625 (P3X84_11625) - 2501591..2501929 (+) 339 WP_277836306.1 phage head closure protein -
  P3X84_RS11630 (P3X84_11630) - 2501922..2502407 (+) 486 WP_277836307.1 HK97-gp10 family putative phage morphogenesis protein -
  P3X84_RS11635 (P3X84_11635) - 2502404..2502772 (+) 369 WP_277836308.1 DUF3168 domain-containing protein -
  P3X84_RS11640 (P3X84_11640) - 2502825..2503340 (+) 516 WP_277836309.1 phage tail tube protein -
  P3X84_RS11645 (P3X84_11645) - 2503349..2503825 (+) 477 WP_277836310.1 phage tail assembly chaperone family protein, TAC -
  P3X84_RS11650 (P3X84_11650) - 2504107..2504910 (+) 804 WP_277836311.1 DUF6694 family lipoprotein -
  P3X84_RS11655 (P3X84_11655) - 2504954..2507362 (+) 2409 WP_277836312.1 phage tail tape measure C-terminal domain-containing protein -
  P3X84_RS11660 (P3X84_11660) - 2507359..2507841 (+) 483 WP_277836313.1 DUF1833 family protein -
  P3X84_RS11665 (P3X84_11665) - 2507854..2508207 (+) 354 WP_277836314.1 hypothetical protein -
  P3X84_RS11670 (P3X84_11670) - 2508217..2508465 (-) 249 WP_277836315.1 hypothetical protein -
  P3X84_RS11675 (P3X84_11675) - 2508616..2509035 (+) 420 WP_277836316.1 hypothetical protein -
  P3X84_RS11680 (P3X84_11680) - 2509007..2512105 (+) 3099 WP_277836317.1 host specificity factor TipJ family phage tail protein -
  P3X84_RS11685 (P3X84_11685) - 2512117..2512599 (+) 483 WP_277836318.1 hypothetical protein -
  P3X84_RS11690 (P3X84_11690) - 2512642..2514579 (+) 1938 WP_277836319.1 hypothetical protein -
  P3X84_RS11695 (P3X84_11695) - 2514605..2515414 (+) 810 WP_277836320.1 hypothetical protein -
  P3X84_RS11700 (P3X84_11700) - 2515512..2516000 (+) 489 WP_277836321.1 glycoside hydrolase family 104 protein -
  P3X84_RS11705 (P3X84_11705) - 2515997..2516521 (+) 525 WP_277836322.1 DUF2514 domain-containing protein -
  P3X84_RS11710 (P3X84_11710) - 2516508..2516903 (-) 396 WP_277836323.1 hypothetical protein -
  P3X84_RS11715 (P3X84_11715) - 2516935..2517702 (-) 768 WP_277836324.1 hypothetical protein -
  P3X84_RS11720 (P3X84_11720) - 2518212..2518523 (-) 312 WP_277836325.1 hypothetical protein -
  P3X84_RS11725 (P3X84_11725) - 2518956..2519132 (-) 177 WP_004577257.1 hypothetical protein -
  P3X84_RS11730 (P3X84_11730) - 2519129..2519452 (-) 324 WP_004577256.1 hypothetical protein -

Sequence


Protein


Download         Length: 166 a.a.        Molecular weight: 18624.81 Da        Isoelectric Point: 7.8775

>NTDB_id=809700 P3X84_RS11490 WP_277836281.1 2484190..2484690(-) (ssb) [Pseudomonas putida strain AHSWHJXPP1]
MSRGVNKVILVGTCGQDPDVRYLPNGNAVTNLSLATSEQWTDKHSGQKVERTEWHRVSLFGKVAEIAGEYLRKGSQCYIE
GKLQTREWEKDGIKRYTTEIIVDINGTMQLLGSRPQGQQPGQAPDRQPRQQQRPARPQQNQQAAPRDHDSFDDDIPFAPL
PFLAGA

Nucleotide


Download         Length: 501 bp        

>NTDB_id=809700 P3X84_RS11490 WP_277836281.1 2484190..2484690(-) (ssb) [Pseudomonas putida strain AHSWHJXPP1]
ATGAGCCGCGGGGTAAACAAGGTCATCCTGGTCGGCACCTGCGGTCAGGACCCGGACGTGCGCTACCTGCCCAACGGCAA
CGCGGTCACCAACCTCAGCCTGGCCACCAGCGAGCAGTGGACGGACAAGCATTCAGGCCAGAAGGTCGAGCGCACCGAGT
GGCACCGCGTCTCGCTGTTCGGCAAGGTTGCGGAGATTGCCGGTGAGTACCTGCGCAAGGGCTCCCAGTGCTACATCGAG
GGCAAGCTGCAGACTCGCGAGTGGGAGAAGGACGGCATCAAGCGCTACACCACTGAAATCATCGTCGACATCAACGGCAC
CATGCAGCTGCTCGGCAGCCGGCCACAGGGTCAGCAGCCTGGGCAAGCGCCAGATCGCCAGCCCCGCCAACAACAGCGCC
CGGCCCGCCCGCAGCAGAACCAGCAGGCCGCGCCGCGGGATCACGACAGCTTCGACGACGACATACCCTTCGCGCCCCTT
CCCTTCCTCGCCGGTGCGTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

54.286

100

0.572

  ssb Glaesserella parasuis strain SC1401

46.409

100

0.506

  ssb Neisseria meningitidis MC58

43.75

100

0.464

  ssb Neisseria gonorrhoeae MS11

43.182

100

0.458