Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | LLNCDO1820_RS05685 | Genome accession | NZ_CP120927 |
| Coordinates | 1088253..1088705 (+) | Length | 150 a.a. |
| NCBI ID | WP_010905690.1 | Uniprot ID | A0AAC9R1D2 |
| Organism | Lactococcus lactis subsp. lactis strain NCDO1820 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1078061..1129593 | 1088253..1088705 | within | 0 |
Gene organization within MGE regions
Location: 1078061..1129593
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLNCDO1820_RS05610 (LLNCDO1820_05600) | - | 1078061..1078717 (+) | 657 | WP_010905677.1 | phosphatase PAP2 family protein | - |
| LLNCDO1820_RS05615 (LLNCDO1820_05605) | glmS | 1078898..1080715 (+) | 1818 | WP_010905678.1 | glutamine--fructose-6-phosphate transaminase (isomerizing) | - |
| LLNCDO1820_RS05620 (LLNCDO1820_05610) | radC | 1080846..1081526 (+) | 681 | WP_003131898.1 | DNA repair protein RadC | - |
| LLNCDO1820_RS05625 (LLNCDO1820_05615) | - | 1081725..1082849 (-) | 1125 | WP_010905679.1 | site-specific integrase | - |
| LLNCDO1820_RS05630 (LLNCDO1820_05620) | - | 1082972..1083517 (-) | 546 | WP_023349242.1 | PH domain-containing protein | - |
| LLNCDO1820_RS05635 (LLNCDO1820_05625) | - | 1083574..1084011 (-) | 438 | WP_010905681.1 | ImmA/IrrE family metallo-endopeptidase | - |
| LLNCDO1820_RS05640 (LLNCDO1820_05630) | - | 1084008..1084550 (-) | 543 | WP_010905682.1 | helix-turn-helix domain-containing protein | - |
| LLNCDO1820_RS05645 (LLNCDO1820_05635) | - | 1084719..1084937 (+) | 219 | WP_010905683.1 | DUF739 family protein | - |
| LLNCDO1820_RS05650 (LLNCDO1820_05640) | - | 1084974..1085717 (+) | 744 | WP_010905684.1 | ORF6C domain-containing protein | - |
| LLNCDO1820_RS05655 (LLNCDO1820_05645) | - | 1085730..1086065 (+) | 336 | WP_003131910.1 | DUF771 domain-containing protein | - |
| LLNCDO1820_RS05660 (LLNCDO1820_05650) | - | 1086203..1086397 (+) | 195 | WP_010905685.1 | hypothetical protein | - |
| LLNCDO1820_RS05665 (LLNCDO1820_05655) | - | 1086394..1086669 (-) | 276 | WP_023349243.1 | hypothetical protein | - |
| LLNCDO1820_RS05670 (LLNCDO1820_05660) | - | 1086772..1086987 (+) | 216 | WP_015966756.1 | DUF1408 domain-containing protein | - |
| LLNCDO1820_RS05675 (LLNCDO1820_05665) | - | 1087103..1087621 (+) | 519 | WP_010905688.1 | host-nuclease inhibitor Gam family protein | - |
| LLNCDO1820_RS05680 (LLNCDO1820_05670) | - | 1087630..1088253 (+) | 624 | WP_010905689.1 | DUF1071 domain-containing protein | - |
| LLNCDO1820_RS05685 (LLNCDO1820_05675) | ssb | 1088253..1088705 (+) | 453 | WP_010905690.1 | single-stranded DNA-binding protein | Machinery gene |
| LLNCDO1820_RS05690 (LLNCDO1820_05680) | - | 1088830..1089612 (+) | 783 | WP_015966758.1 | phage replisome organiser protein | - |
| LLNCDO1820_RS05695 (LLNCDO1820_05685) | - | 1089612..1090337 (+) | 726 | WP_015966759.1 | hypothetical protein | - |
| LLNCDO1820_RS05700 (LLNCDO1820_05690) | - | 1090334..1090723 (+) | 390 | WP_002819817.1 | RusA family crossover junction endodeoxyribonuclease | - |
| LLNCDO1820_RS05705 (LLNCDO1820_05695) | - | 1090726..1090920 (+) | 195 | WP_010905693.1 | hypothetical protein | - |
| LLNCDO1820_RS05710 (LLNCDO1820_05700) | - | 1090913..1091152 (+) | 240 | WP_031297271.1 | DUF1031 family protein | - |
| LLNCDO1820_RS05715 (LLNCDO1820_05705) | - | 1091270..1091530 (+) | 261 | WP_223203848.1 | hypothetical protein | - |
| LLNCDO1820_RS05720 (LLNCDO1820_05710) | - | 1091552..1091731 (+) | 180 | WP_010905696.1 | DUF1497 domain-containing protein | - |
| LLNCDO1820_RS05725 (LLNCDO1820_05715) | - | 1091721..1092290 (+) | 570 | WP_010905697.1 | DUF658 family protein | - |
| LLNCDO1820_RS05730 (LLNCDO1820_05725) | - | 1092484..1092690 (+) | 207 | WP_010905356.1 | DUF1125 domain-containing protein | - |
| LLNCDO1820_RS05735 (LLNCDO1820_05730) | - | 1092683..1092955 (+) | 273 | WP_010905357.1 | hypothetical protein | - |
| LLNCDO1820_RS05740 (LLNCDO1820_05735) | - | 1092952..1093506 (+) | 555 | WP_010905358.1 | DUF1642 domain-containing protein | - |
| LLNCDO1820_RS05745 (LLNCDO1820_05740) | - | 1093503..1093922 (+) | 420 | WP_010905698.1 | dUTP diphosphatase | - |
| LLNCDO1820_RS05750 (LLNCDO1820_05745) | - | 1093925..1094422 (+) | 498 | WP_010905699.1 | hypothetical protein | - |
| LLNCDO1820_RS05755 (LLNCDO1820_05750) | - | 1094415..1094759 (+) | 345 | WP_223203818.1 | hypothetical protein | - |
| LLNCDO1820_RS05760 (LLNCDO1820_05755) | - | 1094781..1094945 (+) | 165 | WP_010905701.1 | hypothetical protein | - |
| LLNCDO1820_RS05765 (LLNCDO1820_05760) | - | 1094992..1095177 (+) | 186 | WP_010905702.1 | hypothetical protein | - |
| LLNCDO1820_RS05770 (LLNCDO1820_05765) | - | 1095219..1095392 (+) | 174 | WP_010905703.1 | DUF1660 domain-containing protein | - |
| LLNCDO1820_RS05775 (LLNCDO1820_05770) | - | 1095393..1095692 (+) | 300 | WP_010905704.1 | hypothetical protein | - |
| LLNCDO1820_RS05780 (LLNCDO1820_05775) | - | 1095689..1095871 (+) | 183 | WP_010905705.1 | hypothetical protein | - |
| LLNCDO1820_RS05785 (LLNCDO1820_05780) | - | 1096235..1096528 (+) | 294 | WP_010905707.1 | DUF1359 domain-containing protein | - |
| LLNCDO1820_RS05790 (LLNCDO1820_05785) | - | 1096606..1097007 (+) | 402 | WP_010905708.1 | RinA family protein | - |
| LLNCDO1820_RS05795 (LLNCDO1820_05790) | - | 1097271..1097570 (+) | 300 | WP_023349146.1 | HNH endonuclease | - |
| LLNCDO1820_RS05800 (LLNCDO1820_05795) | - | 1097662..1098030 (+) | 369 | WP_010905710.1 | P27 family phage terminase small subunit | - |
| LLNCDO1820_RS05805 (LLNCDO1820_05800) | - | 1098023..1099792 (+) | 1770 | WP_032941531.1 | terminase large subunit | - |
| LLNCDO1820_RS05810 (LLNCDO1820_05805) | - | 1099806..1101011 (+) | 1206 | WP_010905712.1 | phage portal protein | - |
| LLNCDO1820_RS05815 (LLNCDO1820_05810) | - | 1101026..1101622 (+) | 597 | WP_010905713.1 | HK97 family phage prohead protease | - |
| LLNCDO1820_RS05820 (LLNCDO1820_05815) | - | 1101594..1102787 (+) | 1194 | WP_010905714.1 | phage major capsid protein | - |
| LLNCDO1820_RS05825 (LLNCDO1820_05820) | - | 1102842..1103699 (+) | 858 | WP_010905715.1 | hypothetical protein | - |
| LLNCDO1820_RS05830 (LLNCDO1820_05825) | - | 1103692..1103973 (+) | 282 | WP_010905716.1 | hypothetical protein | - |
| LLNCDO1820_RS05835 (LLNCDO1820_05830) | - | 1103960..1104277 (+) | 318 | WP_010905717.1 | phage head closure protein | - |
| LLNCDO1820_RS05840 (LLNCDO1820_05835) | - | 1104267..1104638 (+) | 372 | WP_010905718.1 | HK97 gp10 family phage protein | - |
| LLNCDO1820_RS05845 (LLNCDO1820_05840) | - | 1104635..1104952 (+) | 318 | WP_010905719.1 | hypothetical protein | - |
| LLNCDO1820_RS05850 (LLNCDO1820_05845) | - | 1104970..1105578 (+) | 609 | WP_010905720.1 | major tail protein | - |
| LLNCDO1820_RS05855 (LLNCDO1820_05850) | - | 1105588..1105947 (+) | 360 | WP_010905721.1 | hypothetical protein | - |
| LLNCDO1820_RS05860 (LLNCDO1820_05855) | - | 1105998..1106150 (+) | 153 | WP_032947787.1 | hypothetical protein | - |
| LLNCDO1820_RS05865 (LLNCDO1820_05860) | - | 1106164..1108425 (+) | 2262 | WP_010905723.1 | phage tail tape measure protein | - |
| LLNCDO1820_RS05870 (LLNCDO1820_05865) | - | 1108426..1109175 (+) | 750 | WP_010905724.1 | hypothetical protein | - |
| LLNCDO1820_RS05875 (LLNCDO1820_05870) | - | 1109172..1111856 (+) | 2685 | WP_023349144.1 | phage tail spike protein | - |
| LLNCDO1820_RS05880 (LLNCDO1820_05875) | - | 1111869..1113470 (+) | 1602 | WP_010905726.1 | DUF2479 domain-containing protein | - |
| LLNCDO1820_RS05885 (LLNCDO1820_05880) | - | 1113463..1114293 (+) | 831 | WP_010905727.1 | hypothetical protein | - |
| LLNCDO1820_RS05890 (LLNCDO1820_05885) | - | 1114746..1115084 (+) | 339 | WP_010905729.1 | hypothetical protein | - |
| LLNCDO1820_RS05895 (LLNCDO1820_05890) | - | 1115086..1115313 (+) | 228 | WP_010905730.1 | hypothetical protein | - |
| LLNCDO1820_RS05900 (LLNCDO1820_05895) | - | 1115339..1115563 (+) | 225 | WP_010905731.1 | hemolysin XhlA family protein | - |
| LLNCDO1820_RS05905 (LLNCDO1820_05900) | - | 1115576..1115863 (+) | 288 | WP_010905732.1 | phage holin | - |
| LLNCDO1820_RS05910 (LLNCDO1820_05905) | - | 1115863..1116642 (+) | 780 | WP_010905733.1 | peptidoglycan amidohydrolase family protein | - |
| LLNCDO1820_RS05915 (LLNCDO1820_05910) | - | 1117144..1117794 (-) | 651 | WP_023349143.1 | redox-sensing transcriptional repressor Rex | - |
| LLNCDO1820_RS05920 (LLNCDO1820_05915) | - | 1118019..1118411 (+) | 393 | WP_003132739.1 | Spx/MgsR family RNA polymerase-binding regulatory protein | - |
| LLNCDO1820_RS05925 (LLNCDO1820_05920) | - | 1118589..1120496 (+) | 1908 | WP_021214548.1 | ABC-F family ATP-binding cassette domain-containing protein | - |
| LLNCDO1820_RS05930 (LLNCDO1820_05925) | - | 1120685..1121485 (+) | 801 | WP_010905736.1 | hypothetical protein | - |
| LLNCDO1820_RS05935 (LLNCDO1820_05930) | - | 1121487..1121852 (+) | 366 | WP_003132744.1 | hypothetical protein | - |
| LLNCDO1820_RS05940 (LLNCDO1820_05935) | - | 1122368..1122553 (+) | 186 | WP_003132749.1 | hypothetical protein | - |
| LLNCDO1820_RS05945 (LLNCDO1820_05940) | - | 1122728..1123585 (+) | 858 | WP_010905739.1 | XRE/MutR family transcriptional regulator | - |
| LLNCDO1820_RS05950 (LLNCDO1820_05945) | - | 1123832..1124563 (+) | 732 | WP_003132752.1 | hypothetical protein | - |
| LLNCDO1820_RS05955 (LLNCDO1820_05950) | - | 1124573..1124755 (+) | 183 | WP_003132753.1 | hypothetical protein | - |
| LLNCDO1820_RS05960 (LLNCDO1820_05955) | - | 1124789..1124977 (+) | 189 | WP_017864422.1 | hypothetical protein | - |
| LLNCDO1820_RS05965 (LLNCDO1820_05960) | - | 1125042..1125203 (+) | 162 | WP_021214547.1 | hypothetical protein | - |
| LLNCDO1820_RS05970 (LLNCDO1820_05965) | - | 1125676..1125804 (-) | 129 | WP_003132757.1 | hypothetical protein | - |
| LLNCDO1820_RS05975 (LLNCDO1820_05970) | pyrE | 1125785..1126414 (+) | 630 | WP_003132758.1 | orotate phosphoribosyltransferase | - |
| LLNCDO1820_RS05980 (LLNCDO1820_05975) | - | 1126569..1127840 (+) | 1272 | WP_031296484.1 | dihydroorotase | - |
| LLNCDO1820_RS05985 (LLNCDO1820_05980) | - | 1128247..1128915 (+) | 669 | WP_010905741.1 | DnaD domain-containing protein | - |
| LLNCDO1820_RS05990 (LLNCDO1820_05985) | nth | 1128937..1129593 (+) | 657 | WP_003130627.1 | endonuclease III | - |
Sequence
Protein
Download Length: 150 a.a. Molecular weight: 16643.67 Da Isoelectric Point: 8.9728
>NTDB_id=809379 LLNCDO1820_RS05685 WP_010905690.1 1088253..1088705(+) (ssb) [Lactococcus lactis subsp. lactis strain NCDO1820]
MINNVVLVGRLTRDPELRHTPQNQAVGTFGLAVNRQFKNANGEREADFINCVIWRQQAENLAKFAKKGALIGITGRIQTR
NYENQQGQKVYVTEVVADTFQMLESNKTQGQQTSKPQAQNKKPQAPDPFKAPAADPFAGGTEISDDDLPF
MINNVVLVGRLTRDPELRHTPQNQAVGTFGLAVNRQFKNANGEREADFINCVIWRQQAENLAKFAKKGALIGITGRIQTR
NYENQQGQKVYVTEVVADTFQMLESNKTQGQQTSKPQAQNKKPQAPDPFKAPAADPFAGGTEISDDDLPF
Nucleotide
Download Length: 453 bp
>NTDB_id=809379 LLNCDO1820_RS05685 WP_010905690.1 1088253..1088705(+) (ssb) [Lactococcus lactis subsp. lactis strain NCDO1820]
ATGATTAATAATGTTGTATTAGTAGGTCGCTTAACTCGTGACCCTGAACTTAGACATACACCACAGAACCAAGCAGTAGG
TACATTTGGATTAGCTGTAAATCGCCAGTTTAAAAATGCGAATGGCGAACGTGAGGCTGATTTCATTAACTGCGTTATTT
GGCGACAACAAGCCGAAAATTTAGCTAAGTTTGCTAAAAAAGGAGCTTTGATTGGAATAACTGGACGGATTCAAACAAGG
AACTATGAGAACCAACAAGGACAAAAAGTTTATGTTACCGAAGTTGTTGCAGATACTTTCCAAATGCTAGAAAGCAATAA
AACACAAGGTCAGCAAACAAGTAAACCGCAAGCTCAAAATAAAAAGCCACAAGCACCAGACCCTTTTAAAGCTCCTGCTG
CTGATCCATTTGCTGGTGGTACTGAAATTTCAGATGATGACCTACCATTTTAA
ATGATTAATAATGTTGTATTAGTAGGTCGCTTAACTCGTGACCCTGAACTTAGACATACACCACAGAACCAAGCAGTAGG
TACATTTGGATTAGCTGTAAATCGCCAGTTTAAAAATGCGAATGGCGAACGTGAGGCTGATTTCATTAACTGCGTTATTT
GGCGACAACAAGCCGAAAATTTAGCTAAGTTTGCTAAAAAAGGAGCTTTGATTGGAATAACTGGACGGATTCAAACAAGG
AACTATGAGAACCAACAAGGACAAAAAGTTTATGTTACCGAAGTTGTTGCAGATACTTTCCAAATGCTAGAAAGCAATAA
AACACAAGGTCAGCAAACAAGTAAACCGCAAGCTCAAAATAAAAAGCCACAAGCACCAGACCCTTTTAAAGCTCCTGCTG
CTGATCCATTTGCTGGTGGTACTGAAATTTCAGATGATGACCTACCATTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
58.14 |
100 |
0.667 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
52.907 |
100 |
0.607 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.654 |
69.333 |
0.407 |
| ssb | Neisseria meningitidis MC58 |
34.302 |
100 |
0.393 |
| ssb | Neisseria gonorrhoeae MS11 |
33.721 |
100 |
0.387 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
52.381 |
70 |
0.367 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
51.429 |
70 |
0.36 |