Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   P4829_RS12995 Genome accession   NZ_CP120846
Coordinates   2580252..2580626 (-) Length   124 a.a.
NCBI ID   WP_063638544.1    Uniprot ID   -
Organism   Bacillus atrophaeus strain MBLB1156     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2575252..2585626
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  P4829_RS12955 (P4829_12955) - 2575550..2576344 (+) 795 WP_003325443.1 YqhG family protein -
  P4829_RS12960 (P4829_12960) sinI 2576534..2576707 (+) 174 WP_003325442.1 anti-repressor SinI family protein Regulator
  P4829_RS12965 (P4829_12965) sinR 2576741..2577076 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  P4829_RS12970 (P4829_12970) - 2577268..2578050 (-) 783 WP_063638541.1 TasA family protein -
  P4829_RS12975 (P4829_12975) - 2578114..2578686 (-) 573 WP_010789195.1 signal peptidase I -
  P4829_RS12980 (P4829_12980) tapA 2578670..2579371 (-) 702 WP_063638542.1 amyloid fiber anchoring/assembly protein TapA -
  P4829_RS12985 (P4829_12985) - 2579633..2579956 (+) 324 WP_063638543.1 DUF3889 domain-containing protein -
  P4829_RS12990 (P4829_12990) - 2580003..2580182 (-) 180 WP_003325435.1 YqzE family protein -
  P4829_RS12995 (P4829_12995) comGG 2580252..2580626 (-) 375 WP_063638544.1 competence type IV pilus minor pilin ComGG Machinery gene
  P4829_RS13000 (P4829_13000) comGF 2580627..2581022 (-) 396 WP_309484978.1 competence type IV pilus minor pilin ComGF Machinery gene
  P4829_RS13005 (P4829_13005) comGE 2581036..2581383 (-) 348 WP_063638545.1 competence type IV pilus minor pilin ComGE Machinery gene
  P4829_RS13010 (P4829_13010) comGD 2581367..2581807 (-) 441 WP_063638546.1 competence type IV pilus minor pilin ComGD Machinery gene
  P4829_RS13015 (P4829_13015) comGC 2581797..2582105 (-) 309 WP_087941811.1 competence type IV pilus major pilin ComGC Machinery gene
  P4829_RS13020 (P4829_13020) comGB 2582111..2583148 (-) 1038 WP_063638547.1 competence type IV pilus assembly protein ComGB Machinery gene
  P4829_RS13025 (P4829_13025) comGA 2583135..2584205 (-) 1071 WP_063638548.1 competence type IV pilus ATPase ComGA Machinery gene
  P4829_RS13030 (P4829_13030) - 2584607..2585560 (-) 954 WP_061572822.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 124 a.a.        Molecular weight: 14328.51 Da        Isoelectric Point: 10.0971

>NTDB_id=808851 P4829_RS12995 WP_063638544.1 2580252..2580626(-) (comGG) [Bacillus atrophaeus strain MBLB1156]
MSRSKGFIYPAVLFAAAVILLVVGYTSSEYIIRKTFEKETKEFYIRENLLQNGALLSIRHILEGRQGQKGSRQFEYGLVS
YQIQSTSKKEQKEINVKSVTNSGSEMTARFIFDLKQKKVIHWEE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=808851 P4829_RS12995 WP_063638544.1 2580252..2580626(-) (comGG) [Bacillus atrophaeus strain MBLB1156]
ATGTCACGGTCGAAAGGCTTTATTTATCCTGCTGTGCTTTTTGCAGCAGCTGTTATTTTGCTCGTTGTCGGTTATACATC
GTCGGAATATATCATCCGTAAAACATTTGAAAAGGAGACCAAAGAATTTTACATCAGGGAAAATTTACTGCAAAATGGCG
CACTTCTGTCCATTCGTCATATACTTGAGGGCCGTCAAGGACAAAAAGGCTCACGGCAATTTGAATATGGGCTGGTGTCT
TATCAAATTCAAAGCACATCAAAAAAAGAGCAAAAAGAGATCAATGTAAAATCTGTCACGAATTCAGGCTCGGAAATGAC
CGCCCGGTTCATATTTGATTTGAAACAAAAAAAAGTTATTCATTGGGAAGAATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

62.097

100

0.621