Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   P4829_RS12960 Genome accession   NZ_CP120846
Coordinates   2576534..2576707 (+) Length   57 a.a.
NCBI ID   WP_003325442.1    Uniprot ID   -
Organism   Bacillus atrophaeus strain MBLB1156     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2571534..2581707
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  P4829_RS12945 (P4829_12945) gcvT 2572303..2573397 (-) 1095 WP_063638539.1 glycine cleavage system aminomethyltransferase GcvT -
  P4829_RS12950 (P4829_12950) - 2573858..2575529 (+) 1672 Protein_2514 SNF2-related protein -
  P4829_RS12955 (P4829_12955) - 2575550..2576344 (+) 795 WP_003325443.1 YqhG family protein -
  P4829_RS12960 (P4829_12960) sinI 2576534..2576707 (+) 174 WP_003325442.1 anti-repressor SinI family protein Regulator
  P4829_RS12965 (P4829_12965) sinR 2576741..2577076 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  P4829_RS12970 (P4829_12970) - 2577268..2578050 (-) 783 WP_063638541.1 TasA family protein -
  P4829_RS12975 (P4829_12975) - 2578114..2578686 (-) 573 WP_010789195.1 signal peptidase I -
  P4829_RS12980 (P4829_12980) tapA 2578670..2579371 (-) 702 WP_063638542.1 amyloid fiber anchoring/assembly protein TapA -
  P4829_RS12985 (P4829_12985) - 2579633..2579956 (+) 324 WP_063638543.1 DUF3889 domain-containing protein -
  P4829_RS12990 (P4829_12990) - 2580003..2580182 (-) 180 WP_003325435.1 YqzE family protein -
  P4829_RS12995 (P4829_12995) comGG 2580252..2580626 (-) 375 WP_063638544.1 competence type IV pilus minor pilin ComGG Machinery gene
  P4829_RS13000 (P4829_13000) comGF 2580627..2581022 (-) 396 WP_309484978.1 competence type IV pilus minor pilin ComGF Machinery gene
  P4829_RS13005 (P4829_13005) comGE 2581036..2581383 (-) 348 WP_063638545.1 competence type IV pilus minor pilin ComGE Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6813.90 Da        Isoelectric Point: 10.0469

>NTDB_id=808849 P4829_RS12960 WP_003325442.1 2576534..2576707(+) (sinI) [Bacillus atrophaeus strain MBLB1156]
MKNAKKELLELDQEWVELMKRAREANINPEEIRKYLYLHKKSAHPVPATRSHTINPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=808849 P4829_RS12960 WP_003325442.1 2576534..2576707(+) (sinI) [Bacillus atrophaeus strain MBLB1156]
ATGAAAAATGCAAAAAAAGAGCTTTTAGAATTAGATCAAGAATGGGTTGAATTAATGAAAAGAGCCAGAGAAGCAAATAT
CAACCCGGAGGAGATACGCAAATATTTATATTTGCATAAAAAGTCTGCTCATCCTGTCCCAGCCACCAGAAGTCATACCA
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

78.947

100

0.789