Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   P6S76_RS11210 Genome accession   NZ_CP120641
Coordinates   2391252..2391689 (-) Length   145 a.a.
NCBI ID   WP_007408322.1    Uniprot ID   -
Organism   Bacillus velezensis strain YL2021     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2386252..2396689
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  P6S76_RS11160 sinI 2386636..2386809 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  P6S76_RS11165 sinR 2386843..2387178 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  P6S76_RS11170 - 2387226..2388011 (-) 786 WP_007408329.1 TasA family protein -
  P6S76_RS11175 - 2388076..2388660 (-) 585 WP_007408328.1 signal peptidase I -
  P6S76_RS11180 tapA 2388632..2389303 (-) 672 WP_020954230.1 amyloid fiber anchoring/assembly protein TapA -
  P6S76_RS11185 - 2389562..2389891 (+) 330 WP_020954231.1 DUF3889 domain-containing protein -
  P6S76_RS11190 - 2389931..2390110 (-) 180 WP_003153093.1 YqzE family protein -
  P6S76_RS11195 comGG 2390167..2390544 (-) 378 WP_007408325.1 competence type IV pilus minor pilin ComGG Machinery gene
  P6S76_RS11200 comGF 2390545..2391045 (-) 501 WP_258566475.1 competence type IV pilus minor pilin ComGF -
  P6S76_RS11205 comGE 2390954..2391268 (-) 315 WP_007408323.1 competence type IV pilus minor pilin ComGE -
  P6S76_RS11210 comGD 2391252..2391689 (-) 438 WP_007408322.1 competence type IV pilus minor pilin ComGD Machinery gene
  P6S76_RS11215 comGC 2391679..2391987 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  P6S76_RS11220 comGB 2391992..2393029 (-) 1038 WP_007408321.1 competence type IV pilus assembly protein ComGB Machinery gene
  P6S76_RS11225 comGA 2393016..2394086 (-) 1071 WP_007408320.1 competence type IV pilus ATPase ComGA Machinery gene
  P6S76_RS11230 - 2394278..2395228 (-) 951 WP_007408319.1 magnesium transporter CorA family protein -
  P6S76_RS11235 - 2395374..2396675 (+) 1302 WP_007408318.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16314.79 Da        Isoelectric Point: 10.2475

>NTDB_id=807414 P6S76_RS11210 WP_007408322.1 2391252..2391689(-) (comGD) [Bacillus velezensis strain YL2021]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPVYTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=807414 P6S76_RS11210 WP_007408322.1 2391252..2391689(-) (comGD) [Bacillus velezensis strain YL2021]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGTCTACACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAGATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCCTTTGATTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

56.164

100

0.566