Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   P6S76_RS11160 Genome accession   NZ_CP120641
Coordinates   2386636..2386809 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain YL2021     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2381636..2391809
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  P6S76_RS11145 gcvT 2382449..2383549 (-) 1101 WP_007408332.1 glycine cleavage system aminomethyltransferase GcvT -
  P6S76_RS11150 - 2383973..2385643 (+) 1671 WP_007408331.1 SNF2-related protein -
  P6S76_RS11155 - 2385665..2386459 (+) 795 WP_007408330.1 YqhG family protein -
  P6S76_RS11160 sinI 2386636..2386809 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  P6S76_RS11165 sinR 2386843..2387178 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  P6S76_RS11170 - 2387226..2388011 (-) 786 WP_007408329.1 TasA family protein -
  P6S76_RS11175 - 2388076..2388660 (-) 585 WP_007408328.1 signal peptidase I -
  P6S76_RS11180 tapA 2388632..2389303 (-) 672 WP_020954230.1 amyloid fiber anchoring/assembly protein TapA -
  P6S76_RS11185 - 2389562..2389891 (+) 330 WP_020954231.1 DUF3889 domain-containing protein -
  P6S76_RS11190 - 2389931..2390110 (-) 180 WP_003153093.1 YqzE family protein -
  P6S76_RS11195 comGG 2390167..2390544 (-) 378 WP_007408325.1 competence type IV pilus minor pilin ComGG Machinery gene
  P6S76_RS11200 comGF 2390545..2391045 (-) 501 WP_258566475.1 competence type IV pilus minor pilin ComGF -
  P6S76_RS11205 comGE 2390954..2391268 (-) 315 WP_007408323.1 competence type IV pilus minor pilin ComGE -
  P6S76_RS11210 comGD 2391252..2391689 (-) 438 WP_007408322.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=807411 P6S76_RS11160 WP_003153105.1 2386636..2386809(+) (sinI) [Bacillus velezensis strain YL2021]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=807411 P6S76_RS11160 WP_003153105.1 2386636..2386809(+) (sinI) [Bacillus velezensis strain YL2021]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702