Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | P6S76_RS11160 | Genome accession | NZ_CP120641 |
| Coordinates | 2386636..2386809 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain YL2021 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2381636..2391809
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P6S76_RS11145 | gcvT | 2382449..2383549 (-) | 1101 | WP_007408332.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| P6S76_RS11150 | - | 2383973..2385643 (+) | 1671 | WP_007408331.1 | SNF2-related protein | - |
| P6S76_RS11155 | - | 2385665..2386459 (+) | 795 | WP_007408330.1 | YqhG family protein | - |
| P6S76_RS11160 | sinI | 2386636..2386809 (+) | 174 | WP_003153105.1 | anti-repressor SinI family protein | Regulator |
| P6S76_RS11165 | sinR | 2386843..2387178 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| P6S76_RS11170 | - | 2387226..2388011 (-) | 786 | WP_007408329.1 | TasA family protein | - |
| P6S76_RS11175 | - | 2388076..2388660 (-) | 585 | WP_007408328.1 | signal peptidase I | - |
| P6S76_RS11180 | tapA | 2388632..2389303 (-) | 672 | WP_020954230.1 | amyloid fiber anchoring/assembly protein TapA | - |
| P6S76_RS11185 | - | 2389562..2389891 (+) | 330 | WP_020954231.1 | DUF3889 domain-containing protein | - |
| P6S76_RS11190 | - | 2389931..2390110 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| P6S76_RS11195 | comGG | 2390167..2390544 (-) | 378 | WP_007408325.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| P6S76_RS11200 | comGF | 2390545..2391045 (-) | 501 | WP_258566475.1 | competence type IV pilus minor pilin ComGF | - |
| P6S76_RS11205 | comGE | 2390954..2391268 (-) | 315 | WP_007408323.1 | competence type IV pilus minor pilin ComGE | - |
| P6S76_RS11210 | comGD | 2391252..2391689 (-) | 438 | WP_007408322.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=807411 P6S76_RS11160 WP_003153105.1 2386636..2386809(+) (sinI) [Bacillus velezensis strain YL2021]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=807411 P6S76_RS11160 WP_003153105.1 2386636..2386809(+) (sinI) [Bacillus velezensis strain YL2021]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |