Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   P5647_RS12355 Genome accession   NZ_CP120622
Coordinates   2412395..2412778 (-) Length   127 a.a.
NCBI ID   WP_003230168.1    Uniprot ID   -
Organism   Bacillus subtilis strain DSM 1090     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2407395..2417778
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  P5647_RS12315 (P5647_12315) sinI 2408329..2408502 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  P5647_RS12320 (P5647_12320) sinR 2408536..2408871 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  P5647_RS12325 (P5647_12325) tasA 2408964..2409749 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  P5647_RS12330 (P5647_12330) sipW 2409813..2410385 (-) 573 WP_003246088.1 signal peptidase I SipW -
  P5647_RS12335 (P5647_12335) tapA 2410369..2411130 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  P5647_RS12340 (P5647_12340) yqzG 2411402..2411728 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  P5647_RS12345 (P5647_12345) spoIITA 2411770..2411949 (-) 180 WP_003230176.1 YqzE family protein -
  P5647_RS12350 (P5647_12350) comGG 2412020..2412394 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  P5647_RS12355 (P5647_12355) comGF 2412395..2412778 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  P5647_RS12360 (P5647_12360) comGE 2412804..2413151 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  P5647_RS12365 (P5647_12365) comGD 2413135..2413566 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  P5647_RS12370 (P5647_12370) comGC 2413556..2413852 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  P5647_RS12375 (P5647_12375) comGB 2413866..2414904 (-) 1039 Protein_2396 comG operon protein ComGB -
  P5647_RS12380 (P5647_12380) comGA 2414891..2415961 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  P5647_RS12385 (P5647_12385) corA 2416373..2417326 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14281.37 Da        Isoelectric Point: 5.8929

>NTDB_id=807137 P5647_RS12355 WP_003230168.1 2412395..2412778(-) (comGF) [Bacillus subtilis strain DSM 1090]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=807137 P5647_RS12355 WP_003230168.1 2412395..2412778(-) (comGF) [Bacillus subtilis strain DSM 1090]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
GGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAAGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

100

100

1