Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   P5647_RS12315 Genome accession   NZ_CP120622
Coordinates   2408329..2408502 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain DSM 1090     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2403329..2413502
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  P5647_RS12300 (P5647_12300) gcvT 2404128..2405216 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  P5647_RS12305 (P5647_12305) hepAA 2405658..2407331 (+) 1674 WP_004398544.1 SNF2-related protein -
  P5647_RS12310 (P5647_12310) yqhG 2407352..2408146 (+) 795 WP_277687258.1 YqhG family protein -
  P5647_RS12315 (P5647_12315) sinI 2408329..2408502 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  P5647_RS12320 (P5647_12320) sinR 2408536..2408871 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  P5647_RS12325 (P5647_12325) tasA 2408964..2409749 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  P5647_RS12330 (P5647_12330) sipW 2409813..2410385 (-) 573 WP_003246088.1 signal peptidase I SipW -
  P5647_RS12335 (P5647_12335) tapA 2410369..2411130 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  P5647_RS12340 (P5647_12340) yqzG 2411402..2411728 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  P5647_RS12345 (P5647_12345) spoIITA 2411770..2411949 (-) 180 WP_003230176.1 YqzE family protein -
  P5647_RS12350 (P5647_12350) comGG 2412020..2412394 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  P5647_RS12355 (P5647_12355) comGF 2412395..2412778 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  P5647_RS12360 (P5647_12360) comGE 2412804..2413151 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=807134 P5647_RS12315 WP_003230187.1 2408329..2408502(+) (sinI) [Bacillus subtilis strain DSM 1090]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=807134 P5647_RS12315 WP_003230187.1 2408329..2408502(+) (sinI) [Bacillus subtilis strain DSM 1090]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1