Detailed information
Overview
| Name | comGD | Type | Machinery gene |
| Locus tag | LLUC147_RS11160 | Genome accession | NZ_CP120473 |
| Coordinates | 2185530..2185718 (-) | Length | 62 a.a. |
| NCBI ID | WP_014573336.1 | Uniprot ID | - |
| Organism | Lactococcus cremoris strain UC147 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 2180530..2190718
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLUC147_RS11125 (LLUC147_11160) | - | 2181456..2182265 (-) | 810 | WP_011677177.1 | metal ABC transporter permease | - |
| LLUC147_RS11130 (LLUC147_11165) | - | 2182258..2182995 (-) | 738 | WP_011677178.1 | metal ABC transporter ATP-binding protein | - |
| LLUC147_RS11135 (LLUC147_11170) | - | 2183174..2184016 (-) | 843 | WP_011677179.1 | metal ABC transporter solute-binding protein, Zn/Mn family | - |
| LLUC147_RS11140 (LLUC147_11175) | - | 2184013..2184450 (-) | 438 | WP_011677180.1 | zinc-dependent MarR family transcriptional regulator | - |
| LLUC147_RS11145 (LLUC147_11180) | comGG | 2184530..2184757 (-) | 228 | WP_228764408.1 | competence protein ComGG | Machinery gene |
| LLUC147_RS11150 (LLUC147_11185) | comGF | 2184853..2185299 (-) | 447 | WP_011836043.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| LLUC147_RS11155 (LLUC147_11190) | comGE | 2185262..2185558 (-) | 297 | WP_021164977.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| LLUC147_RS11160 (LLUC147_11195) | comGD | 2185530..2185718 (-) | 189 | WP_014573336.1 | hypothetical protein | Machinery gene |
| LLUC147_RS11165 (LLUC147_11200) | comGC | 2185920..2186297 (-) | 378 | Protein_2174 | competence type IV pilus major pilin ComGC | - |
| LLUC147_RS11170 (LLUC147_11205) | comGB | 2186315..2187340 (-) | 1026 | WP_050574185.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| LLUC147_RS11175 (LLUC147_11210) | comGA | 2187240..2188220 (-) | 981 | WP_162494683.1 | competence type IV pilus ATPase ComGA | Machinery gene |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7336.65 Da Isoelectric Point: 8.3463
>NTDB_id=805804 LLUC147_RS11160 WP_014573336.1 2185530..2185718(-) (comGD) [Lactococcus cremoris strain UC147]
MIYENKEIDIPKEVEMAEFLIIFDEKGGNSSLQKIKVYLPYEKKTILYQMEMGSGKYKKKIN
MIYENKEIDIPKEVEMAEFLIIFDEKGGNSSLQKIKVYLPYEKKTILYQMEMGSGKYKKKIN
Nucleotide
Download Length: 189 bp
>NTDB_id=805804 LLUC147_RS11160 WP_014573336.1 2185530..2185718(-) (comGD) [Lactococcus cremoris strain UC147]
TTGATTTATGAAAACAAAGAGATAGATATTCCCAAAGAGGTTGAAATGGCAGAATTTTTGATTATATTTGATGAGAAAGG
GGGGAACTCAAGTTTACAGAAAATCAAAGTTTATTTACCTTATGAGAAGAAAACAATTTTATATCAAATGGAGATGGGGA
GTGGAAAATATAAAAAGAAAATCAATTAA
TTGATTTATGAAAACAAAGAGATAGATATTCCCAAAGAGGTTGAAATGGCAGAATTTTTGATTATATTTGATGAGAAAGG
GGGGAACTCAAGTTTACAGAAAATCAAAGTTTATTTACCTTATGAGAAGAAAACAATTTTATATCAAATGGAGATGGGGA
GTGGAAAATATAAAAAGAAAATCAATTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGD | Lactococcus lactis subsp. cremoris KW2 |
93.548 |
100 |
0.935 |
| comYD | Streptococcus mutans UA140 |
43.396 |
85.484 |
0.371 |
| comYD | Streptococcus mutans UA159 |
43.396 |
85.484 |
0.371 |